DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AT1G06260

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_563764.1 Gene:AT1G06260 / 837137 AraportID:AT1G06260 Length:343 Species:Arabidopsis thaliana


Alignment Length:347 Identity:125/347 - (36%)
Similarity:183/347 - (52%) Gaps:56/347 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 SVEWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGS 349
            ||:.:....||....||:       |:.....:.|....|..:|..|::.|::.|:.:|:..:  
plant    27 SVDSSVYDPHKTLKQRFE-------KWLKTHSKLYGGRDEWMLRFGIYQSNVQLIDYINSLHL-- 82

  Fly   350 AKYGITE--FADMTSSEYKERTGLWQRDEAKATGGSAAVV-----------PAYHGELPKEFDWR 401
             .:.:|:  |||||:||:|          |...|.:.:.:           ||  |.:|...|||
plant    83 -PFKLTDNRFADMTNSEFK----------AHFLGLNTSSLRLHKKQRPVCDPA--GNVPDAVDWR 134

  Fly   402 QKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCD--TTDSACNGGLMDNA 464
            .:.|||.::|||.||.|||||....|||:..:|||.|...|||:|:|||  |.:..|:||||:.|
plant   135 TQGAVTPIRNQGKCGGCWAFSAVAAIEGINKIKTGNLVSLSEQQLIDCDVGTYNKGCSGGLMETA 199

  Fly   465 YKAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSH-VQVAGFVDLPKGNETAMQEWLLANGPISIGI 528
            ::.||..|||..|.:|||...:..|...::.:. |.:.|:..:.: ||.::| ...|..|:|:||
plant   200 FEFIKTNGGLATETDYPYTGIEGTCDQEKSKNKVVTIQGYQKVAQ-NEASLQ-IAAAQQPVSVGI 262

  Fly   529 NANA--MQFYRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQG 591
            :|..  .|.|..||   :...|. .||:|||.||||||..      ...|||||||||..|||:|
plant   263 DAGGFIFQLYSSGV---FTNYCG-TNLNHGVTVVGYGVEG------DQKYWIVKNSWGTGWGEEG 317

  Fly   592 YYRVYRG--DNT--CGVSEMAT 609
            |.|:.||  ::|  ||::.||:
plant   318 YIRMERGVSEDTGKCGIAMMAS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 15/58 (26%)
Peptidase_C1A 395..611 CDD:239068 97/224 (43%)
AT1G06260NP_563764.1 Inhibitor_I29 43..98 CDD:214853 15/64 (23%)
Peptidase_C1 127..341 CDD:365882 97/225 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.