DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and CEP1

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_568722.1 Gene:CEP1 / 835091 AraportID:AT5G50260 Length:361 Species:Arabidopsis thaliana


Alignment Length:309 Identity:128/309 - (41%)
Similarity:172/309 - (55%) Gaps:39/309 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 STAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSSEYKERT---------GLWQRDE 376
            |..|:..|..:|:.|:|.|.|.|..:. |.|..:.:|.||||.|:: ||         .::| .|
plant    50 SLEEKAKRFNVFKHNVKHIHETNKKDK-SYKLKLNKFGDMTSEEFR-RTYAGSNIKHHRMFQ-GE 111

  Fly   377 AKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEF 441
            .|||   .:.:.|....||...|||:..|||.|||||.||||||||....:||:..::|.:|...
plant   112 KKAT---KSFMYANVNTLPTSVDWRKNGAVTPVKNQGQCGSCWAFSTVVAVEGINQIRTKKLTSL 173

  Fly   442 SEQELLDCDTT-DSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQCHFNR-TLSHVQVAGFV 504
            |||||:||||. :..|||||||.|::.||:.|||..|..|||||....|..|: ....|.:.|..
plant   174 SEQELVDCDTNQNQGCNGGLMDLAFEFIKEKGGLTSELVYPYKASDETCDTNKENAPVVSIDGHE 238

  Fly   505 DLPKGNETAMQEWLLANGPISIGINANA--MQFYRGGVSHPWKALCSKKNLDHGVLVVGYGVSDY 567
            |:||.:|..:.: .:||.|:|:.|:|..  .|||..||   :...|..: |:|||.|||||.   
plant   239 DVPKNSEDDLMK-AVANQPVSVAIDAGGSDFQFYSEGV---FTGRCGTE-LNHGVAVVGYGT--- 295

  Fly   568 PNFHKTL---PYWIVKNSWGPRWGEQGYYRVYRG----DNTCGVSEMAT 609
                 |:   .|||||||||..|||:||.|:.||    :..||::..|:
plant   296 -----TIDGTKYWIVKNSWGEEWGEKGYIRMQRGIRHKEGLCGIAMEAS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 16/43 (37%)
Peptidase_C1A 395..611 CDD:239068 102/226 (45%)
CEP1NP_568722.1 Inhibitor_I29 38..92 CDD:214853 16/42 (38%)
Peptidase_C1 126..342 CDD:278538 103/227 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.