DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and SAG12

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_568651.1 Gene:SAG12 / 834629 AraportID:AT5G45890 Length:346 Species:Arabidopsis thaliana


Alignment Length:349 Identity:126/349 - (36%)
Similarity:180/349 - (51%) Gaps:49/349 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 NQPVVQARHTRSVEWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKT 338
            |:.::|.||   :||..|                       .||.|....|...|..:|:.|::.
plant    30 NELIMQKRH---IEWMTK-----------------------HGRVYADVKEENNRYVVFKNNVER 68

  Fly   339 IEELNANEMG-SAKYGITEFADMTSSEYKERTGLWQRDEAKATGGSAAVVPAYH-----GELPKE 397
            ||.||:...| :.|..:.:|||:|:.|::.....::...|.::.....:.|..:     |.||..
plant    69 IEHLNSIPAGRTFKLAVNQFADLTNDEFRSMYTGFKGVSALSSQSQTKMSPFRYQNVSSGALPVS 133

  Fly   398 FDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTTDSACNGGLMD 462
            .|||:|.|||.:|||||||.|||||....|||...:|.|:|...|||:|:||||.|..|.|||||
plant   134 VDWRKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCEGGLMD 198

  Fly   463 NAYKAIKDIGGLEYEAEYPYKAKKNQCHFNRT-LSHVQVAGFVDLPKGNETAMQEWLLANGPISI 526
            .|::.||..|||..|:.||||.:...|:..:| .....:.|:.|:|..:|.|:.: .:|:.|:|:
plant   199 TAFEHIKATGGLTTESNYPYKGEDATCNSKKTNPKATSITGYEDVPVNDEQALMK-AVAHQPVSV 262

  Fly   527 GINANA--MQFYRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGE 589
            ||....  .|||..||   :...|: ..|||.|..:|||.|  .|..|   |||:|||||.:|||
plant   263 GIEGGGFDFQFYSSGV---FTGECT-TYLDHAVTAIGYGES--TNGSK---YWIIKNSWGTKWGE 318

  Fly   590 QGYYRVYRG----DNTCGVSEMAT 609
            .||.|:.:.    ...||::..|:
plant   319 SGYMRIQKDVKDKQGLCGLAMKAS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 17/57 (30%)
Peptidase_C1A 395..611 CDD:239068 97/222 (44%)
SAG12NP_568651.1 Inhibitor_I29 38..95 CDD:214853 21/82 (26%)
Peptidase_C1 130..345 CDD:395062 98/223 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I4419
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.