DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and RD21B

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_568620.1 Gene:RD21B / 834321 AraportID:AT5G43060 Length:463 Species:Arabidopsis thaliana


Alignment Length:327 Identity:129/327 - (39%)
Similarity:187/327 - (57%) Gaps:41/327 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 KVDHLFYKFQVRFGRRYVST----AERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSS 363
            :|:.::..:.|..|::.::.    ||:..|..||:.||:.|:|.|...: |.|.|:|.|||:|:.
plant    45 EVERIYEAWMVEHGKKKMNQNGLGAEKDQRFEIFKDNLRFIDEHNTKNL-SYKLGLTRFADLTNE 108

  Fly   364 EYKE--------RTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWA 420
            ||:.        :..|...|..:|..|.|         ||...|||::.||..||:|||||||||
plant   109 EYRSMYLGAKPTKRVLKTSDRYQARVGDA---------LPDSVDWRKEGAVADVKDQGSCGSCWA 164

  Fly   421 FSVTGNIEGLYAVKTGELKEFSEQELLDCDTT-DSACNGGLMDNAYKAIKDIGGLEYEAEYPYKA 484
            ||..|.:||:..:.||:|...|||||:||||: :..|||||||.|::.|...||::.||:|||||
plant   165 FSTIGAVEGINKIVTGDLISLSEQELVDCDTSYNQGCNGGLMDYAFEFIIKNGGIDTEADYPYKA 229

  Fly   485 KKNQCHFNR-TLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINA--NAMQFYRGGVSHPWKA 546
            ...:|..|| ....|.:..:.|:|:.:|.:::: .||:.|||:.|.|  .|.|.|..||   :..
plant   230 ADGRCDQNRKNAKVVTIDSYEDVPENSEASLKK-ALAHQPISVAIEAGGRAFQLYSSGV---FDG 290

  Fly   547 LCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG----DNTCGVSEM 607
            ||..: |||||:.||||..:..:      ||||:||||.||||.||.::.|.    ...||::..
plant   291 LCGTE-LDHGVVAVGYGTENGKD------YWIVRNSWGNRWGESGYIKMARNIEAPTGKCGIAME 348

  Fly   608 AT 609
            |:
plant   349 AS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 20/60 (33%)
Peptidase_C1A 395..611 CDD:239068 100/223 (45%)
RD21BNP_568620.1 Inhibitor_I29 50..109 CDD:214853 20/59 (34%)
Peptidase_C1 138..353 CDD:278538 101/224 (45%)
GRAN 377..433 CDD:197621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.