DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and RD19

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_568052.1 Gene:RD19 / 830064 AraportID:AT4G39090 Length:368 Species:Arabidopsis thaliana


Alignment Length:325 Identity:133/325 - (40%)
Similarity:194/325 - (59%) Gaps:34/325 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 DHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTI---EELNANEMGSAKYGITEFADMTSSEY- 365
            || |..|:.:||:.|.|..|...|..:|:.||:..   ::|:.    ||.:|:|:|:|:|.||: 
plant    49 DH-FSLFKRKFGKVYASNEEHDYRFSVFKANLRRARRHQKLDP----SATHGVTQFSDLTRSEFR 108

  Fly   366 KERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGL 430
            |:..|:....:.......|.::|..:  ||::||||...|||.|||||||||||:||.||.:||.
plant   109 KKHLGVRSGFKLPKDANKAPILPTEN--LPEDFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGA 171

  Fly   431 YAVKTGELKEFSEQELLDC---------DTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKK 486
            ..:.||:|...|||:|:||         |:.||.||||||::|::.....|||..|.:|||..|.
plant   172 NFLATGKLVSLSEQQLVDCDHECDPEEADSCDSGCNGGLMNSAFEYTLKTGGLMKEEDYPYTGKD 236

  Fly   487 NQ-CHFNRTLSHVQVAGF----VDLPKGNETAMQEWLLANGPISIGINANAMQFYRGGVSHPWKA 546
            .: |..:::.....|:.|    :|     |..:...|:.|||:::.|||..||.|.||||.|:  
plant   237 GKTCKLDKSKIVASVSNFSVISID-----EEQIAANLVKNGPLAVAINAGYMQTYIGGVSCPY-- 294

  Fly   547 LCSKKNLDHGVLVVGYGVSDY-PNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMATS 610
            :|::: |:||||:||||.:.| |...|..||||:|||||..|||.|:|::.:|.|.|||..|.::
plant   295 ICTRR-LNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVST 358

  Fly   611  610
            plant   359  358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 20/59 (34%)
Peptidase_C1A 395..611 CDD:239068 105/231 (45%)
RD19NP_568052.1 Inhibitor_I29 51..106 CDD:214853 19/58 (33%)
Peptidase_C1 135..359 CDD:395062 106/232 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 226 1.000 Domainoid score I673
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H111629
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264766at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2557
orthoMCL 1 0.900 - - OOG6_100116
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3186
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.