DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and XCP1

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_567983.1 Gene:XCP1 / 829688 AraportID:AT4G35350 Length:355 Species:Arabidopsis thaliana


Alignment Length:323 Identity:133/323 - (41%)
Similarity:189/323 - (58%) Gaps:21/323 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 KHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADM 360
            :|....||:..||..:.....:.|.|..|:..|..:||:||..|::.| ||:.|...|:.||||:
plant    39 EHLTNTDKLLELFESWMSEHSKAYKSVEEKVHRFEVFRENLMHIDQRN-NEINSYWLGLNEFADL 102

  Fly   361 TSSEYKER-TGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVT 424
            |..|:|.| .||.:...::....||........:|||..|||:|.||..||:||.||||||||..
plant   103 THEEFKGRYLGLAKPQFSRKRQPSANFRYRDITDLPKSVDWRKKGAVAPVKDQGQCGSCWAFSTV 167

  Fly   425 GNIEGLYAVKTGELKEFSEQELLDCDTT-DSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQ 488
            ..:||:..:.||.|...|||||:||||| :|.|||||||.|::.|...|||..|.:|||..::..
plant   168 AAVEGINQITTGNLSSLSEQELIDCDTTFNSGCNGGLMDYAFQYIISTGGLHKEDDYPYLMEEGI 232

  Fly   489 CHFNR-TLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANA--MQFYRGGVSHPWKALCSK 550
            |...: .:..|.::|:.|:|:.::.::.: .||:.|:|:.|.|:.  .|||:|||   :...|. 
plant   233 CQEQKEDVERVTISGYEDVPENDDESLVK-ALAHQPVSVAIEASGRDFQFYKGGV---FNGKCG- 292

  Fly   551 KNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG----DNTCGVSEMAT 609
            .:|||||..||||.|      |...|.||||||||||||:|:.|:.|.    :..||:::||:
plant   293 TDLDHGVAAVGYGSS------KGSDYVIVKNSWGPRWGEKGFIRMKRNTGKPEGLCGINKMAS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 20/56 (36%)
Peptidase_C1A 395..611 CDD:239068 101/223 (45%)
XCP1NP_567983.1 Inhibitor_I29 51..106 CDD:214853 20/55 (36%)
Peptidase_C1 137..352 CDD:395062 102/224 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.