DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AT4G16190

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_567489.1 Gene:AT4G16190 / 827311 AraportID:AT4G16190 Length:373 Species:Arabidopsis thaliana


Alignment Length:322 Identity:132/322 - (40%)
Similarity:193/322 - (59%) Gaps:25/322 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 DHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEM--GSAKYGITEFADMTSSEYKE 367
            :|.|..|:.::.:.|.:..|...|.|:|:.||:   ....|::  .||.:|:|:|:|:|..|::.
plant    52 EHHFTLFKSKYEKTYATQVEHDHRFRVFKANLR---RARRNQLLDPSAVHGVTQFSDLTPKEFRR 113

  Fly   368 R-TGLWQRDEAKATG-GSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGL 430
            : .||.:|.....|. .:|.::|.  .:||.|||||::.|||.|||||.|||||:||..|.:||.
plant   114 KFLGLKRRGFRLPTDTQTAPILPT--SDLPTEFDWREQGAVTPVKNQGMCGSCWSFSAIGALEGA 176

  Fly   431 YAVKTGELKEFSEQELLDCD---------TTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKK 486
            :.:.|.||...|||:|:|||         :.||.|:||||:||::.....|||..|.:|||..:.
plant   177 HFLATKELVSLSEQQLVDCDHECDPAQANSCDSGCSGGLMNNAFEYALKAGGLMKEEDYPYTGRD 241

  Fly   487 N-QCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQFYRGGVSHPWKALCSK 550
            : .|.|:::.....|:.| .:...:|..:...|:.:||::|.|||..||.|.||||.|:  :|||
plant   242 HTACKFDKSKIVASVSNF-SVVSSDEDQIAANLVQHGPLAIAINAMWMQTYIGGVSCPY--VCSK 303

  Fly   551 KNLDHGVLVVGYGVSDY-PNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DNTCGVSEMATS 610
            .. |||||:||:|.|.| |...|..||||:|||||..|||.|||::.|| .|.||:..|.::
plant   304 SQ-DHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGMDTMVST 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 17/58 (29%)
Peptidase_C1A 395..611 CDD:239068 106/228 (46%)
AT4G16190NP_567489.1 Inhibitor_I29 55..110 CDD:214853 17/57 (30%)
Peptidase_C1 140..365 CDD:278538 107/229 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 226 1.000 Domainoid score I673
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H111629
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264766at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2557
orthoMCL 1 0.900 - - OOG6_100116
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.