DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AT4G11320

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001328659.1 Gene:AT4G11320 / 826734 AraportID:AT4G11320 Length:371 Species:Arabidopsis thaliana


Alignment Length:367 Identity:121/367 - (32%)
Similarity:182/367 - (49%) Gaps:64/367 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 DEHEITF-KCRNQPVVQARHTRSVEWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQM 327
            |.|.:|. ..|.|.:..|..|.                      :|..:.|:.|:.|.|.||::.
plant    33 DNHHVTAGPGRRQGIFDAEATL----------------------MFESWMVKHGKVYDSVAEKER 75

  Fly   328 RLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSSEYKE------------RTGLWQRDEAKAT 380
            ||.||..||:.|...||..: |.:.|:..|||::..||.|            ...:...:..|.:
plant    76 RLTIFEDNLRFITNRNAENL-SYRLGLNRFADLSLHEYGEICHGADPRPPRNHVFMTSSNRYKTS 139

  Fly   381 GGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQE 445
            .|..         |||..|||.:.|||:||:||.|.||||||..|.:|||..:.||||...|||:
plant   140 DGDV---------LPKSVDWRNEGAVTEVKDQGLCRSCWAFSTVGAVEGLNKIVTGELVTLSEQD 195

  Fly   446 LLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQC--HFNRTLSHVQVAGFVDLPK 508
            |::|:..::.|.||.::.||:.|.:.|||..:.:|||||....|  .......:|.:.|:.:||.
plant   196 LINCNKENNGCGGGKVETAYEFIMNNGGLGTDNDYPYKALNGVCEGRLKEDNKNVMIDGYENLPA 260

  Fly   509 GNETAMQEWLLANGPISIGINANAMQF--YRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFH 571
            .:|.|:.: .:|:.|::..:::::.:|  |..||   :...|. .||:|||:|||||..:..:  
plant   261 NDEAALMK-AVAHQPVTAVVDSSSREFQLYESGV---FDGTCG-TNLNHGVVVVGYGTENGRD-- 318

  Fly   572 KTLPYWIVKNSWGPRWGEQGYYRVYRG----DNTCGVSEMAT 609
                |||||||.|..|||.||.::.|.    ...||::..|:
plant   319 ----YWIVKNSRGDTWGEAGYMKMARNIANPRGLCGIAMRAS 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856 3/8 (38%)
Inhibitor_I29 308..365 CDD:285458 21/56 (38%)
Peptidase_C1A 395..611 CDD:239068 87/223 (39%)
AT4G11320NP_001328659.1 Inhibitor_I29 56..111 CDD:214853 21/55 (38%)
Peptidase_C1 144..359 CDD:278538 88/224 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.