DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsF and AT3G43960

DIOPT Version :10

Sequence 1:NP_730901.1 Gene:CtsF / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_566867.1 Gene:AT3G43960 / 823513 AraportID:AT3G43960 Length:376 Species:Arabidopsis thaliana


Alignment Length:171 Identity:37/171 - (21%)
Similarity:64/171 - (37%) Gaps:59/171 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QQKMHMFSTETALRKFQINTQSDTIYVNLNYLAEL---------SEYFHILRTGFYSEMTAEKV- 57
            ::|:.:.|.|..::|...:|...|..:| :.|||:         .|.:|.......|...::|| 
plant   515 EEKVFIISEEPPMKKMASSTPPPTSSIN-SMLAEIFCQSGSSEDQEEWHAQVVEELSNFKSQKVL 578

  Fly    58 NLNDVFAEDLVVFLSYVCPDGFEFDRTINQHNITPLVYFSDRL-VFPWVKREVHKY--------- 112
            .||    ||                         ||.::|||| :||.:.:.:.||         
plant   579 GLN----ED-------------------------PLKWWSDRLTLFPLLPKVLQKYWCIRPTRVF 614

  Fly   113 ----LNSEA-----FQNEIYDTELLVQLCYLLHSQNYSEID 144
                .||.|     .:|.:....:..|:....:::|.||.:
plant   615 PERLFNSSANVVNSKRNRLAPAHVDEQIFLYENTRNCSEAE 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsFNP_730901.1 Inhibitor_I29 308..365 CDD:462410
Peptidase_C1A 395..611 CDD:239068
AT3G43960NP_566867.1 Inhibitor_I29 41..97 CDD:214853
Peptidase_C1 127..346 CDD:425470
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.