DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and CYSA

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_181620.1 Gene:CYSA / 818685 AraportID:AT2G40880 Length:125 Species:Arabidopsis thaliana


Alignment Length:101 Identity:26/101 - (25%)
Similarity:42/101 - (41%) Gaps:16/101 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SSETTTDQAVSEPPITLVHVL----NPGEREYLSPNLIGVQNIAMTFLPLSMNFVNIIDAFREIT 100
            |.|.:|::.:.   :..||.|    |.||.|.|:...|...|.....:   :.|..|:.|..::.
plant    24 SEEKSTEKTMM---LGGVHDLRGNQNSGEIESLARFAIQEHNKQQNKI---LEFKKIVKAREQVV 82

  Fly   101 AGVRYEILLNALDTKAIQPAEADIVCRLVILEKPWL 136
            ||..|.:.|.|.:....:..||.      :..|||:
plant    83 AGTMYHLTLEAKEGDQTKNFEAK------VWVKPWM 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458
Peptidase_C1A 395..611 CDD:239068
CYSANP_181620.1 CY 33..121 CDD:214484 23/92 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.