DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AT2G34080

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_565780.1 Gene:AT2G34080 / 817969 AraportID:AT2G34080 Length:345 Species:Arabidopsis thaliana


Alignment Length:338 Identity:115/338 - (34%)
Similarity:166/338 - (49%) Gaps:34/338 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 TRSVEWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEM 347
            :|:|.:.|:....||.           ::..||.|.|....|:.||..:|::|||.||..|....
plant    25 SRTVIFREQSMVDKHE-----------QWMARFSREYRDELEKNMRRDVFKKNLKFIENFNKKGN 78

  Fly   348 GSAKYGITEFADMTSSEYKE-RTGLWQRDEAKATGGSAAVVPAYHGELP----KEFDWRQKDAVT 407
            .|.|.|:.||||.|:.|:.. .|||....|...:...|..:.:....:.    :..|||.:.|||
plant    79 KSYKLGVNEFADWTNEEFLAIHTGLKGLTEVSPSKVVAKTISSQTWNVSDMVVESKDWRAEGAVT 143

  Fly   408 QVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT-DSACNGGLMDNAYKAIKDI 471
            .||.||.||.|||||....:||:..:..|.|...|||:|||||.. |..|:||:|.:|:..:...
plant   144 PVKYQGQCGCCWAFSAVAAVEGVAKIAGGNLVSLSEQQLLDCDREYDRGCDGGIMSDAFNYVVQN 208

  Fly   472 GGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQF- 535
            .|:..|.:|.|:.....|..|...: .:::||..:|..||.|:.| .::..|:|:.::|....| 
plant   209 RGIASENDYSYQGSDGGCRSNARPA-ARISGFQTVPSNNERALLE-AVSRQPVSVSMDATGDGFM 271

  Fly   536 -YRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG- 598
             |.|||   :...|...: :|.|..||||.|     .....||:.|||||..|||:||.|:.|. 
plant   272 HYSGGV---YDGPCGTSS-NHAVTFVGYGTS-----QDGTKYWLAKNSWGETWGEKGYIRIRRDV 327

  Fly   599 ---DNTCGVSEMA 608
               ...|||::.|
plant   328 AWPQGMCGVAQYA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 22/56 (39%)
Peptidase_C1A 395..611 CDD:239068 82/225 (36%)
AT2G34080NP_565780.1 Inhibitor_I29 39..95 CDD:214853 23/66 (35%)
Peptidase_C1 132..344 CDD:395062 82/220 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I4419
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.