DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AT2G22160

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_179806.1 Gene:AT2G22160 / 816750 AraportID:AT2G22160 Length:105 Species:Arabidopsis thaliana


Alignment Length:98 Identity:26/98 - (26%)
Similarity:43/98 - (43%) Gaps:1/98 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 GRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSSEYKERTGLWQRDEAKAT 380
            |...|...:.:....:|::|.:.|.:.| .|....|..:.:||::|..|:......:...:.|..
plant     2 GHYLVPIHQTESSFDVFKKNAEYIVKTN-KERKPYKLKLNKFANLTDVEFVNAHTCFDMSDHKKI 65

  Fly   381 GGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQG 413
            ..|.........:.|...|||:|.|||.||:||
plant    66 LDSKPFFYENMTQAPDSLDWREKGAVTNVKDQG 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 11/48 (23%)
Peptidase_C1A 395..611 CDD:239068 12/19 (63%)
AT2G22160NP_179806.1 Inhibitor_I29 <15..50 CDD:304561 9/35 (26%)
Peptidase_C1 79..>98 CDD:304901 10/18 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.