DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AT2G21430

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_565512.1 Gene:AT2G21430 / 816682 AraportID:AT2G21430 Length:361 Species:Arabidopsis thaliana


Alignment Length:326 Identity:133/326 - (40%)
Similarity:192/326 - (58%) Gaps:36/326 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 DHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMG-SAKYGITEFADMTSSEYKER 368
            || |..|:.:||:.|.|..|...|..:|:.||  :..:...:|. ||::|:|:|:|:|.||::  
plant    46 DH-FTLFKKKFGKVYGSIEEHYYRFSVFKANL--LRAMRHQKMDPSARHGVTQFSDLTRSEFR-- 105

  Fly   369 TGLWQRDEAKATGG--------SAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTG 425
                 |......||        .|.::|..:  ||:|||||.:.|||.|||||||||||:||.||
plant   106 -----RKHLGVKGGFKLPKDANQAPILPTQN--LPEEFDWRDRGAVTPVKNQGSCGSCWSFSTTG 163

  Fly   426 NIEGLYAVKTGELKEFSEQELLDCD---------TTDSACNGGLMDNAYKAIKDIGGLEYEAEYP 481
            .:||.:.:.||:|...|||:|:|||         :.||.||||||::|::.....|||..|.:||
plant   164 ALEGAHFLATGKLVSLSEQQLVDCDHECDPEEEGSCDSGCNGGLMNSAFEYTLKTGGLMREKDYP 228

  Fly   482 YKAKK-NQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQFYRGGVSHPWK 545
            |.... ..|..:|:.....|:.| .:...||..:...|:.|||:::.|||..||.|.||||.|: 
plant   229 YTGTDGGSCKLDRSKIVASVSNF-SVVSINEDQIAANLIKNGPLAVAINAAYMQTYIGGVSCPY- 291

  Fly   546 ALCSKKNLDHGVLVVGYGVSDYPNFH-KTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMAT 609
             :||:: |:||||:||||.:.:.... |..||||:|||||..|||.|:|::.:|.|.|||..:.:
plant   292 -ICSRR-LNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVS 354

  Fly   610 S 610
            :
plant   355 T 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 20/57 (35%)
Peptidase_C1A 395..611 CDD:239068 104/227 (46%)
AT2G21430NP_565512.1 Inhibitor_I29 48..103 CDD:214853 19/56 (34%)
Peptidase_C1 132..356 CDD:395062 105/228 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 226 1.000 Domainoid score I673
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H111629
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264766at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2557
orthoMCL 1 0.900 - - OOG6_100116
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3186
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.