DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctsw

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001039033.1 Gene:ctsw / 733785 XenbaseID:XB-GENE-963153 Length:303 Species:Xenopus tropicalis


Alignment Length:314 Identity:103/314 - (32%)
Similarity:167/314 - (53%) Gaps:39/314 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 VRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSSE---YKERTG---- 370
            :::.|.|.:..|.:.|||||.:|||....|...|:|:|:||:|:|:|:|..|   |...|.    
 Frog     2 LQYNRSYKTREEFKYRLRIFSENLKEASRLQREELGTAQYGVTKFSDLTDEEFSIYHLPTNILPT 66

  Fly   371 ---LWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYA 432
               |.|.:|         |:|     .|...|||.::.:::.|||.:|.|||||:...|||..:|
 Frog    67 PPILKQSEE---------VLP-----FPTSCDWRTQNVISKAKNQRTCHSCWAFAAVANIEAQWA 117

  Fly   433 VKTGELKEFSEQELLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSH 497
            : .|:....|||:::||:|..:.|:||...:|:..:...|||..|..|||....:.|.     ..
 Frog   118 I-LGQTISLSEQQVIDCNTCRNGCSGGYAWDAFMTVLQQGGLTSEKSYPYTGHVSNCR-----KG 176

  Fly   498 VQVAGFV---DLPKGNETAMQEWLLANGPISIGINANAMQFYRGGVSHPWKALCSKKNLDHGVLV 559
            .:..|::   ::.|.|||||...:...|.:::.||...::.|:.|:....::.|....:||.||:
 Frog   177 FEAVGWIHDFEMLKKNETAMASHVAHKGTLTVTINKAPLKHYQKGIVDTLRSNCDPNYVDHVVLI 241

  Fly   560 VGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMATSAVL 613
            |||....      .||.||:|||||..|||:|::|::|..|.||:::...:.::
 Frog   242 VGYRGGG------KLPQWILKNSWGEDWGEKGFFRMFRDKNACGITKYPVTCIV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 22/54 (41%)
Peptidase_C1A 395..611 CDD:239068 74/218 (34%)
ctswNP_001039033.1 Inhibitor_I29 1..53 CDD:214853 21/50 (42%)
Peptidase_C1A 80..285 CDD:239068 74/216 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I10947
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264766at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.