DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Cts8

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001121688.1 Gene:Cts8 / 680718 RGDID:1588248 Length:333 Species:Rattus norvegicus


Alignment Length:329 Identity:114/329 - (34%)
Similarity:166/329 - (50%) Gaps:41/329 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 EWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAK 351
            ||.|.||                    ::.:.|....|.|.| .::.:|:|.:::.|. |....|
  Rat    28 EWQEWKT--------------------KYEKNYSLEEEGQKR-AVWEENMKVVKQHNI-EYDQEK 70

  Fly   352 YGIT----EFADMTSSEY-KERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKN 411
            ...|    .|||||..|: |..|.:..::..|    ..::.......|||..|||::..||.|||
  Rat    71 KNFTMELNAFADMTGEEFRKMMTNIPVQNLRK----KKSIHQPIFRYLPKFVDWRRRGYVTSVKN 131

  Fly   412 QGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTTDS--ACNGGLMDNAYKAIKDIGGL 474
            ||:|.|||||||.|.|||....|||.|...|.|.|:||...:.  .|:.|....|.|.:...|||
  Rat   132 QGTCNSCWAFSVAGAIEGQMFRKTGRLVSLSPQNLVDCSRPEGNHGCHMGSTLYALKYVWSNGGL 196

  Fly   475 EYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINAN--AMQFYR 537
            |.|:.|||:.|:..|.:....|..:|.||..:.: :|.|:...:...||||:||:|:  :.:|||
  Rat   197 EAESTYPYEGKEGPCRYLPRRSAARVTGFSTVAR-SEEALMHAVATIGPISVGIDASHVSFRFYR 260

  Fly   538 GGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DNT 601
            .|:.  ::..||...::|.|||||||.....:..:  .||::|||.|..||..||.::.|| :|.
  Rat   261 RGIY--YEPRCSSNRINHSVLVVGYGYEGRESDGR--KYWLIKNSHGVGWGMNGYMKLARGWNNH 321

  Fly   602 CGVS 605
            ||::
  Rat   322 CGIA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 15/60 (25%)
Peptidase_C1A 395..611 CDD:239068 89/216 (41%)
Cts8NP_001121688.1 PTZ00203 5..327 CDD:185513 114/329 (35%)
Inhibitor_I29 29..87 CDD:214853 19/79 (24%)
Peptidase_C1A 115..331 CDD:239068 89/216 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.