DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctsb

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_072119.2 Gene:Ctsb / 64529 RGDID:621509 Length:339 Species:Rattus norvegicus


Alignment Length:264 Identity:69/264 - (26%)
Similarity:106/264 - (40%) Gaps:59/264 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 LPKEFD----WRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKT-GELK-EFSEQELLDC--D 450
            ||:.||    |.....:.|:::||||||||||.....:.....:.| |.:. |.|.::||.|  .
  Rat    80 LPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGI 144

  Fly   451 TTDSACNGGLMDNAY-----KAIKDIGGLEYEAE---YPYKAKKNQCHFNRTLSHVQVAGFVDLP 507
            .....||||....|:     |.:  :.|..|.:.   .||.....:.|.|.  |.....|..|.|
  Rat   145 QCGDGCNGGYPSGAWNFWTRKGL--VSGGVYNSHIGCLPYTIPPCEHHVNG--SRPPCTGEGDTP 205

  Fly   508 KGN---------------------------ETAMQEWLLANGPISIGINANAMQF--YRGGVSHP 543
            |.|                           |..:...:..|||:. |.......|  |:.||   
  Rat   206 KCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVE-GAFTVFSDFLTYKSGV--- 266

  Fly   544 WKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMA 608
            :|.........|.:.::|:|:.:      .:|||:|.|||...||:.|::::.||:|.||:....
  Rat   267 YKHEAGDVMGGHAIRILGWGIEN------GVPYWLVANSWNVDWGDNGFFKILRGENHCGIESEI 325

  Fly   609 TSAV 612
            .:.:
  Rat   326 VAGI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458
Peptidase_C1A 395..611 CDD:239068 68/260 (26%)
CtsbNP_072119.2 Propeptide_C1 26..65 CDD:285358
Peptidase_C1A_CathepsinB 81..328 CDD:239111 68/260 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.