DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctsbb

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_005160989.1 Gene:ctsbb / 569298 ZFINID:ZDB-GENE-070323-1 Length:331 Species:Danio rerio


Alignment Length:258 Identity:70/258 - (27%)
Similarity:107/258 - (41%) Gaps:55/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 ELPKEFD----WRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAV--KTGELKEFSEQELLD-CD 450
            :||..||    |.....:.|:::||||||||||....:|.....:  |..:..|.|.::||. ||
Zfish    79 KLPDSFDLRDQWPNCKTLNQIRDQGSCGSCWAFGAVESISDRICIHSKGKQSPEISAEDLLSCCD 143

  Fly   451 TTDSACNGGLMDNAY----KAIKDIGGLEYEAEY---PYKAKKNQCHFNRTLSHVQVAGFVDLPK 508
            .....|:||....|:    ::....||| |.::.   ||.....:.|.|.|  ....:|..|.||
Zfish   144 QCGFGCSGGFPAEAWDYWRRSGLVTGGL-YNSDVGCRPYSIAPCEHHVNGT--RPPCSGEQDTPK 205

  Fly   509 ---------------------------GNETAMQEWLLANGPISIGINA-NAMQFYRGGVSHPWK 545
                                       .::..:...|..|||:...... .....|:.||   ::
Zfish   206 CTGVCIPKYSVPYKQDKHFGSKVYNVPSDQQQIMTELYTNGPVEAAFTVYEDFPLYKSGV---YQ 267

  Fly   546 ALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGV-SEM 607
            .|.......|.|.::|:|..:      ..|:|:|.|||...||:.||:::.||.:.||: |||
Zfish   268 HLTGSALGGHAVKILGWGEEN------GTPFWLVANSWNSDWGDNGYFKILRGHDECGIESEM 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458
Peptidase_C1A 395..611 CDD:239068 69/256 (27%)
ctsbbXP_005160989.1 Propeptide_C1 28..65 CDD:285358
Peptidase_C1A_CathepsinB 81..327 CDD:239111 69/256 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.