DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and si:dkey-228a15.1

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_017207744.1 Gene:si:dkey-228a15.1 / 564472 ZFINID:ZDB-GENE-060503-344 Length:313 Species:Danio rerio


Alignment Length:202 Identity:39/202 - (19%)
Similarity:69/202 - (34%) Gaps:52/202 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 NEKYVHR---SRRSANDILGRHKPYDEEAAKAQLQKSLDKLTAGEGPHYKIVKVYSASRQVDSGI 233
            ::|..:|   :|...||.......::.|.....|....||.:         ::....|.|.:..:
Zfish   151 HKKNTYRLWVTRPEGNDAPATPHRFEMEGFNTLLDSHNDKYS---------IEYSDFSSQTEPDV 206

  Fly   234 LT---RIDADLIDGSEEQHRCIVDIWTKVWVRKDEHEITFKCRNQPVVQARHTRSVEWAEKKTHK 295
            .|   ....:......|||:.:.:                     |:.....|..|         
Zfish   207 FTPPAGFTCEEFPDPPEQHQILAN---------------------PIQDYVSTNPV--------- 241

  Fly   296 KHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADM 360
            .|:||      :|..|:.:|.|:|.|..|.|.|...|.|:.:.:...|...: |...||.:.||.
Zfish   242 SHAHR------MFGPFKEKFNRQYKSEEEHQEREINFVQSFRFVNSTNRKGL-SFTVGINKRADW 299

  Fly   361 TSSEYKE 367
            :.:|.::
Zfish   300 SRAETRK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856 10/80 (13%)
Inhibitor_I29 308..365 CDD:285458 17/56 (30%)
Peptidase_C1A 395..611 CDD:239068
si:dkey-228a15.1XP_017207744.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.