Sequence 1: | NP_730901.1 | Gene: | CG12163 / 40628 | FlyBaseID: | FBgn0260462 | Length: | 614 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017207744.1 | Gene: | si:dkey-228a15.1 / 564472 | ZFINID: | ZDB-GENE-060503-344 | Length: | 313 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 39/202 - (19%) |
---|---|---|---|
Similarity: | 69/202 - (34%) | Gaps: | 52/202 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 172 NEKYVHR---SRRSANDILGRHKPYDEEAAKAQLQKSLDKLTAGEGPHYKIVKVYSASRQVDSGI 233
Fly 234 LT---RIDADLIDGSEEQHRCIVDIWTKVWVRKDEHEITFKCRNQPVVQARHTRSVEWAEKKTHK 295
Fly 296 KHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADM 360
Fly 361 TSSEYKE 367 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12163 | NP_730901.1 | CY | 194..272 | CDD:298856 | 10/80 (13%) |
Inhibitor_I29 | 308..365 | CDD:285458 | 17/56 (30%) | ||
Peptidase_C1A | 395..611 | CDD:239068 | |||
si:dkey-228a15.1 | XP_017207744.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4870 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |