DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and si:dkey-26g8.5

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001096585.1 Gene:si:dkey-26g8.5 / 563390 ZFINID:ZDB-GENE-121214-19 Length:335 Species:Danio rerio


Alignment Length:375 Identity:126/375 - (33%)
Similarity:198/375 - (52%) Gaps:69/375 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 CIVDIWT--KVWVRKDEHEITFKCRNQPVVQARHTRSVEW-AEKKTHKKHSHRFDKVDHLFYKFQ 312
            ||..::|  .:.::.|:|                     | :.|..|.|..|.           .
Zfish    10 CISAVFTAPSIDIQLDDH---------------------WNSWKSQHGKSYHE-----------D 42

  Fly   313 VRFGRRYVSTAERQMRLRIFRQNLKTIEELN-----ANEMGSAKYGITEFADMTSSEYKERTGLW 372
            :..|||           .|:.:||:.||:.|     .|.  :.|.|:.:|.|||:.|:::....:
Zfish    43 LEVGRR-----------MIWEENLRKIEQHNFEYSYGNH--TFKMGMNQFGDMTNEEFRQAMNGY 94

  Fly   373 QRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGE 437
            :.|..:.:.|...:.|::.. .|::.||||:..||.||:|..|||||:||.||.:||....|||:
Zfish    95 KHDPNRTSQGPLFMEPSFFA-APQQVDWRQRGYVTPVKDQKQCGSCWSFSSTGALEGQLFRKTGK 158

  Fly   438 LKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKN-QCHFNRTLSHVQ 499
            |...|||.|:||...  :..||||:||.|::.:|:..||:.|..|||.|:.: .|.::...:..:
Zfish   159 LISMSEQNLVDCSRPQGNQGCNGGIMDQAFQYVKENKGLDSEQSYPYLARDDLPCRYDPRFNVAK 223

  Fly   500 VAGFVDLPKGNETAMQEWLLANGPISIGINAN--AMQFYRGGVSHPWKALCSKKNLDHGVLVVGY 562
            :.||||:|:|||.|:...:.|.||:|:.|:|:  ::|||:.|:.  ::..|:.: |||.||||||
Zfish   224 ITGFVDIPRGNELALMNAVAAVGPVSVAIDASHQSLQFYQSGIY--YERACTSR-LDHAVLVVGY 285

  Fly   563 GV--SDYPNFHKTLPYWIVKNSWGPRWGEQGY-YRVYRGDNTCGVSEMAT 609
            |.  :|.....    ||||||||..:||::|| |.....:|.||::.||:
Zfish   286 GYQGADVAGNR----YWIVKNSWSDKWGDKGYIYMAKDKNNHCGIATMAS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856 5/22 (23%)
Inhibitor_I29 308..365 CDD:285458 16/61 (26%)
Peptidase_C1A 395..611 CDD:239068 96/223 (43%)
si:dkey-26g8.5NP_001096585.1 Inhibitor_I29 28..86 CDD:214853 21/81 (26%)
Peptidase_C1 115..334 CDD:278538 96/224 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.