DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Cts8

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_062414.3 Gene:Cts8 / 56094 MGIID:1860275 Length:333 Species:Mus musculus


Alignment Length:327 Identity:108/327 - (33%)
Similarity:158/327 - (48%) Gaps:45/327 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 VDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNAN-EMGSAKY--GITEFADMTSSEY 365
            :|..:.:::.:|.:.|....|.|.| .::.:|:|.:::.|.. :.|...:  .:..|.|||..||
Mouse    25 LDSEWQEWKRKFNKNYSMEEEGQKR-AVWEENMKLVKQHNIEYDQGKKNFTMDVNAFGDMTGEEY 88

  Fly   366 KERTGLWQRDEAKATGGSAAVVPAYH----------GELPKEFDWRQKDAVTQVKNQGSCGSCWA 420
            ::..             :...||.:.          |.|||..|||::..||.|||||:|.||||
Mouse    89 RKML-------------TDIPVPNFRKKKSIHQPIAGYLPKFVDWRKRGCVTPVKNQGTCNSCWA 140

  Fly   421 FSVTGNIEGLYAVKTGELKEFSEQELLDCDTTDS--ACNGGLMDNAYKAIKDIGGLEYEAEYPYK 483
            ||..|.|||....|||:|...|.|.|:||...:.  .|..|....|.|.:....|||.|:.||||
Mouse   141 FSAAGAIEGQMFRKTGKLVPLSTQNLVDCSRLEGNFGCFKGSTFLALKYVWKNRGLEAESTYPYK 205

  Fly   484 AKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQF--YRGGVSHPWKA 546
            .....|.::...|..::..| .....:|..:...:...||||:||:|....|  ||.|:.:..| 
Mouse   206 GTDGHCRYHPERSAARITSF-SFVSNSEKDLMRAVATIGPISVGIDARHKSFRLYREGIYYEPK- 268

  Fly   547 LCSKKNLDHGVLVVGYGV----SDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DNTCGVSE 606
             ||...::|.|||||||.    ||...      ||::|||.|.:||..||.::.|| :|.||::.
Mouse   269 -CSSNIINHSVLVVGYGYEGKESDGNK------YWLIKNSHGEQWGMNGYMKLARGRNNHCGIAS 326

  Fly   607 MA 608
            .|
Mouse   327 YA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 13/59 (22%)
Peptidase_C1A 395..611 CDD:239068 88/223 (39%)
Cts8NP_062414.3 Inhibitor_I29 29..87 CDD:214853 13/58 (22%)
Peptidase_C1A 115..331 CDD:239068 88/223 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.