DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Cts7

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001346316.1 Gene:Cts7 / 56092 MGIID:1860262 Length:331 Species:Mus musculus


Alignment Length:338 Identity:121/338 - (35%)
Similarity:173/338 - (51%) Gaps:55/338 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 EWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEE---LNANEMG 348
            ||.|.|                     |...|..|..|.:.|..::..|:|.|::   .|...|.
Mouse    28 EWEEWK---------------------RSNDRTYSPEEEKQRRAVWEGNVKWIKQHIMENGLWMN 71

  Fly   349 SAKYGITEFADMTSSEYKERTGLWQRDEAKATGGSAAVVPAYHG--------ELPKEFDWRQKDA 405
            :....:.||.|||..|.|..|             .::..|..:|        ::|...|||::..
Mouse    72 NFTIEMNEFGDMTGEEMKMLT-------------ESSSYPLRNGKHIQKRNPKIPPTLDWRKEGY 123

  Fly   406 VTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAI 468
            ||.|:.|||||:|||||||..|||....|||:|...|.|.|:||..:  ...|:||...:|::.:
Mouse   124 VTPVRRQGSCGACWAFSVTACIEGQLFKKTGKLIPLSVQNLMDCSVSYGTKGCDGGRPYDAFQYV 188

  Fly   469 KDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAM 533
            |:.||||.||.|||:||...|.:....|.|:|..|..:|: ||.|:.:.|:.:|||::.|:.:..
Mouse   189 KNNGGLEAEATYPYEAKAKHCRYRPERSVVKVNRFFVVPR-NEEALLQALVTHGPIAVAIDGSHA 252

  Fly   534 QF--YRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVY 596
            .|  ||||:.|..|  |.|..||||:|:||||...:.:.::  .||::|||.|.||||.||.::.
Mouse   253 SFHSYRGGIYHEPK--CRKDTLDHGLLLVGYGYEGHESENR--KYWLLKNSHGERWGENGYMKLP 313

  Fly   597 RGDNT-CGVSEMA 608
            ||.|. ||::..|
Mouse   314 RGQNNYCGIASYA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 15/59 (25%)
Peptidase_C1A 395..611 CDD:239068 97/219 (44%)
Cts7NP_001346316.1 Inhibitor_I29 29..87 CDD:214853 18/78 (23%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:18776147 33..50 6/37 (16%)
Peptidase_C1A 113..329 CDD:239068 97/219 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.