DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctss2.1

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001019580.2 Gene:ctss2.1 / 554157 ZFINID:ZDB-GENE-050522-559 Length:330 Species:Danio rerio


Alignment Length:334 Identity:112/334 - (33%)
Similarity:178/334 - (53%) Gaps:38/334 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 SHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLK--TIEELNANEMGSAKYGIT--EFA 358
            :|....:|..:..::..:|:.|.:..|...|.:::.:||:  |:..|.|: ||...|.::  ...
Zfish    17 AHFNTNLDQHWELWKKTYGKIYTTEVEEFGRRQLWERNLQLITVHNLEAS-MGMHSYDLSMNHMG 80

  Fly   359 DMTSSEYKERTGL------WQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGS 417
            |:|:.|..:...|      ::|..|...|.|...|       |...|||:|..|:.||.||:|||
Zfish    81 DLTTEEILQTLALTHVPSGFKRQIANIVGSSGDAV-------PDSLDWREKGYVSSVKMQGACGS 138

  Fly   418 CWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYEAEY 480
            |||||..|.:||.....||:|.:.|.|.|:||.:.  :..||||.|.:|::.:.|.||:..::.|
Zfish   139 CWAFSSVGALEGQLKKTTGKLVDLSPQNLVDCSSKYGNKGCNGGFMSDAFQYVIDNGGIASDSAY 203

  Fly   481 PYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQF--YRGGVSHP 543
            ||:..:.||.::.:........:..:.:|:|.|:::.:.:.||||:.|:|...||  |..||.: 
Zfish   204 PYRGVQQQCSYSSSQRAANCTKYYFVRQGDENALKQAVASVGPISVAIDATRPQFVLYHSGVYN- 267

  Fly   544 WKALCSKKNLDHGVLVVGYGVSDYPNFHKTL---PYWIVKNSWGPRWGEQGYYRVYRG-DNTCGV 604
             ...|||: ::|.|||||||         ||   .||:||||||.|:|:.||.|:.|. :|.||:
Zfish   268 -DPTCSKR-VNHAVLVVGYG---------TLSGQDYWLVKNSWGTRFGDGGYIRMARNKNNMCGI 321

  Fly   605 SEMATSAVL 613
            :..|...|:
Zfish   322 ASYACYPVM 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 14/60 (23%)
Peptidase_C1A 395..611 CDD:239068 88/223 (39%)
ctss2.1NP_001019580.2 PTZ00203 6..324 CDD:185513 110/326 (34%)
Inhibitor_I29 27..86 CDD:214853 14/59 (24%)
Peptidase_C1 115..329 CDD:278538 89/232 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.