DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctsk

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001017778.1 Gene:ctsk / 550475 ZFINID:ZDB-GENE-001205-4 Length:333 Species:Danio rerio


Alignment Length:329 Identity:121/329 - (36%)
Similarity:178/329 - (54%) Gaps:26/329 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 SHRFD--KVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNAN-EMGSAKY--GITEF 357
            :|..|  .:|..:..:::...|.|....|..:|..|:.:|:..||..|.. |:|...|  |:..|
Zfish    18 AHSLDNLSLDEAWESWKITHKREYNGLNEESIRRTIWEKNMLFIEAHNKEYELGIHTYDLGMNHF 82

  Fly   358 ADMTSSEYKERT-GL---WQRDEAKATGGSAAVVPAYH-GELPKEFDWRQKDAVTQVKNQGSCGS 417
            .|||..|..|:. ||   ..||.|.      ..||... |:|||..|:|:...||.|||||||||
Zfish    83 GDMTLEEVAEKVMGLQMPMYRDPAN------TFVPDDRVGKLPKSIDYRKLGYVTSVKNQGSCGS 141

  Fly   418 CWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPY 482
            |||||..|.:||......|:|.:.|.|.|:||.|.:..|.||.|.||::.:.:..|::.|..|||
Zfish   142 CWAFSSVGALEGQLMKTKGQLVDLSPQNLVDCVTENDGCGGGYMTNAFRYVSNNQGIDSEESYPY 206

  Fly   483 KAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINA--NAMQFYRGGVSHPWK 545
            .....||.:|.:.......|:.::|:|||.|:...:...||:|:||:|  :...:|:.||.  :.
Zfish   207 VGTDQQCAYNTSGVAASCRGYKEIPQGNERALTAAVANVGPVSVGIDAMQSTFLYYKSGVY--YD 269

  Fly   546 ALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DNTCGVSEMAT 609
            ..|:|::::|.||.||||.:  |...|   |||||||||..||::||..:.|. :|.||::.:|:
Zfish   270 PNCNKEDVNHAVLAVGYGAT--PRGKK---YWIVKNSWGEEWGKKGYVLMARNRNNACGIANLAS 329

  Fly   610 SAVL 613
            ..|:
Zfish   330 FPVM 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 17/59 (29%)
Peptidase_C1A 395..611 CDD:239068 89/218 (41%)
ctskNP_001017778.1 Inhibitor_I29 30..89 CDD:214853 17/58 (29%)
Peptidase_C1 118..332 CDD:278538 90/220 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.