DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12163 and tspan1

DIOPT Version :9

Sequence 1:	NP_730901.1	Gene:	CG12163 / 40628	FlyBaseID:	FBgn0260462	Length:	614	Species:	Drosophila melanogaster
Sequence 2:	NP_001016107.1	Gene:	tspan1 / 548861	XenbaseID:	XB-GENE-868363	Length:	245	Species:	Xenopus tropicalis

Alignment Length:	51	Identity:	16/51 - (31%)
Similarity:	21/51 - (41%)	Gaps:	6/51 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   320 VSTAERQMRLRI---FRQNLKTIEELNANEMGSAKYGI--TEFADMTSSEY 365
            |.|.:..|...:   |.|.:..|.: ||..:|....||  .|.|.|..|.|
Frog   186 VCTQQGAMNSHVSGCFSQLIYLIRQ-NAAIVGGVAAGICALELAAMVVSMY 235

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12163	NP_730901.1	CY	194..272	CDD:298856
		Inhibitor_I29	308..365	CDD:285458	15/49 (31%)
		Peptidase_C1A	395..611	CDD:239068
tspan1	NP_001016107.1	Tetraspannin	7..236	CDD:366035	16/51 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4870
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900