DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctss

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_059016.2 Gene:Ctss / 50654 RGDID:621513 Length:341 Species:Rattus norvegicus


Alignment Length:335 Identity:127/335 - (37%)
Similarity:174/335 - (51%) Gaps:58/335 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 WAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELN-ANEMGSAK 351
            |  ||||:|.           ||.|          .|..:|..|:.:|||.|...| .:.||...
  Rat    40 W--KKTHEKE-----------YKDQ----------NEEDVRRLIWEKNLKFIMLHNLEHSMGMHS 81

  Fly   352 Y--GITEFADMTSSEYKERTGL------WQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQ 408
            |  |:....|||..|.....|.      |.|        |..:..:.:..||...|||:|..||.
  Rat    82 YSVGMNHMGDMTPEEVIGYMGSLRIPRHWNR--------SGTLKSSSNQTLPDSVDWREKGCVTN 138

  Fly   409 VKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTTD----SACNGGLMDNAYKAIK 469
            ||.|||||||||||..|.:||...:|||:|...|.|.|:||.|.:    ..|.||.|..|::.|.
  Rat   139 VKYQGSCGSCWAFSAVGALEGQLKLKTGKLVSLSAQNLVDCSTEEKYGNKGCGGGFMTEAFQYII 203

  Fly   470 DIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQ 534
            |.||::.||.|||||...:||::........:.:::||.|:|.|::|.:...||:|:||:|:...
  Rat   204 DNGGIDSEASYPYKAMDEKCHYDPKNRAATCSRYIELPFGDEEALKEAVATKGPVSVGIDASHSS 268

  Fly   535 F--YRGGV-SHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVY 596
            |  |:.|| ..|   .|: :|::|||||||||..|..:      ||:||||||..:|:|||.|:.
  Rat   269 FFLYQSGVYDDP---SCT-ENVNHGVLVVGYGTLDGKD------YWLVKNSWGLHFGDQGYIRMA 323

  Fly   597 RGD-NTCGVS 605
            |.: |.||::
  Rat   324 RNNKNHCGIA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 18/59 (31%)
Peptidase_C1A 395..611 CDD:239068 97/219 (44%)
CtssNP_059016.2 Inhibitor_I29 37..96 CDD:214853 24/78 (31%)
Peptidase_C1 124..339 CDD:395062 98/220 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.