powered by:
Protein Alignment CG12163 and Ctla2a
DIOPT Version :9
Sequence 1: | NP_730901.1 |
Gene: | CG12163 / 40628 |
FlyBaseID: | FBgn0260462 |
Length: | 614 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006253587.1 |
Gene: | Ctla2a / 498690 |
RGDID: | 1565540 |
Length: | 188 |
Species: | Rattus norvegicus |
Alignment Length: | 66 |
Identity: | 19/66 - (28%) |
Similarity: | 40/66 - (60%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 304 VDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNAN-EMGSAKY--GITEFADMTSSEY 365
:|..:.:::.:||:.|....||..| .::.::.||||..||: :.|...: |:.:|:|:|:.|:
Rat 12 LDTEWEEWKKKFGKTYSPDEERHRR-AVWEESKKTIEAHNADYKQGKTSFYMGLNQFSDLTTEEF 75
Fly 366 K 366
:
Rat 76 R 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.