DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and RGD1564827

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_017456168.1 Gene:RGD1564827 / 498689 RGDID:1564827 Length:333 Species:Rattus norvegicus


Alignment Length:328 Identity:112/328 - (34%)
Similarity:167/328 - (50%) Gaps:47/328 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 VDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGIT----EFADMTSSE 364
            :|..:.|:::::.:.|....|.|.| .::.||:|.| :|:..|.|..|:|.|    .|.|||..|
  Rat    25 LDAEWQKWKIKYEKTYSLEEEGQKR-AVWEQNMKKI-KLHNGENGLGKHGFTMEMNAFGDMTIEE 87

  Fly   365 Y------------KERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGS 417
            :            |:...:.:|...               .:|...:||::..||.|:.||.|.:
  Rat    88 FRKLMIEIPIPTVKKENSVQKRQAV---------------NVPNFINWRKRGYVTPVRRQGRCNA 137

  Fly   418 CWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTTDSACNGGLMDNAYKA---IKDIGGLEYEAE 479
            ||||||.|.|||....|||:|...|.|.|:||..|.... |..:.|.|.|   :|:.||||.||.
  Rat   138 CWAFSVAGAIEGQMFRKTGQLIPLSVQNLVDCSRTQGNL-GCYLGNTYFALQYVKENGGLESEAT 201

  Fly   480 YPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINA--NAMQFYRGGVSH 542
            |||:.|:..|.::...|...:||...:|| ||.|:...:...||||:.|:|  .:..|||.|:.|
  Rat   202 YPYEGKEGSCRYHPDNSTASIAGIEFVPK-NEHALMNAVATLGPISVAIDARHESFLFYRNGIYH 265

  Fly   543 PWKALCSKKNLDHGVLVVGYG-VSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGD-NTCGVS 605
              :..|:...:.|.:|:|||| |.:..:..|   |||||||.|.:||.:||.::.:.. |.||::
  Rat   266 --EPNCNSSVVTHSMLLVGYGFVGEESDGRK---YWIVKNSMGNKWGNRGYMKIAKDQGNHCGIA 325

  Fly   606 EMA 608
            ..|
  Rat   326 TYA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 19/60 (32%)
Peptidase_C1A 395..611 CDD:239068 89/221 (40%)
RGD1564827XP_017456168.1 PTZ00203 2..327 CDD:185513 111/325 (34%)
Inhibitor_I29 29..87 CDD:214853 19/59 (32%)
Peptidase_C1A 115..331 CDD:239068 89/221 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.