DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and MGC114246

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001017509.1 Gene:MGC114246 / 498688 RGDID:1562210 Length:334 Species:Rattus norvegicus


Alignment Length:343 Identity:119/343 - (34%)
Similarity:173/343 - (50%) Gaps:62/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 EWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAK 351
            ||.|.|  ||:...:                   |..|.::|..::.:|||.| :|:..|.|..|
  Rat    28 EWQEWK--KKYDKSY-------------------SLEEEELRRAVWEENLKMI-KLHNGENGLGK 70

  Fly   352 YGIT----EFADMTSSEYKE----------RTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQ 402
            .|.|    ||.|.|..|:::          |.|   :...|...||.         .||..|||:
  Rat    71 NGFTMEINEFGDTTGEEFRKMMVEFPVQTHREG---KSIMKRAAGSI---------FPKFVDWRK 123

  Fly   403 KDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAY 465
            |..||.|:.||:|.:||||||||.||.....::|:|...|.|.|:||...  ::.|.||...||:
  Rat   124 KGYVTPVRRQGNCNACWAFSVTGAIEAQTIWQSGKLIPLSVQNLVDCSKPQGNNGCLGGDTYNAF 188

  Fly   466 KAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINA 530
            :.:...|||:.||.|||:.|...|.:|...|..::.|||.||:..:..|.. :...||||.||:|
  Rat   189 QYVLHNGGLQSEATYPYEGKDGPCRYNPKNSSAEITGFVSLPESEDILMVA-VATIGPISAGIDA 252

  Fly   531 N--AMQFYRGGVSHPWKALCSKKNLDHGVLVVGYGV--SDYPNFHKTLPYWIVKNSWGPRWGEQG 591
            :  :.:||:.|:.|  :..||..::.|||||||||.  :|....|    ||::|||||.:||.:|
  Rat   253 SHESFKFYKKGIYH--EPNCSSNSVTHGVLVVGYGFKGNDTGGDH----YWLIKNSWGKQWGIRG 311

  Fly   592 YYRVYRG-DNTCGVSEMA 608
            |.::.:. :|.|.::..|
  Rat   312 YMKITKDKNNHCAIASYA 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 17/60 (28%)
Peptidase_C1A 395..611 CDD:239068 90/221 (41%)
MGC114246NP_001017509.1 PTZ00203 7..332 CDD:185513 119/343 (35%)
Inhibitor_I29 29..87 CDD:214853 22/79 (28%)
Peptidase_C1A 116..332 CDD:239068 90/221 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.