DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctsz

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001006043.1 Gene:ctsz / 450022 ZFINID:ZDB-GENE-041010-139 Length:301 Species:Danio rerio


Alignment Length:245 Identity:76/245 - (31%)
Similarity:108/245 - (44%) Gaps:61/245 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 ELPKEFDWRQKDAVTQV---KNQ---GSCGSCWAFSVTG------NIEGLYAVKTGELKEFSEQE 445
            |||||:|||....|..|   :||   ..||||||...|.      ||:...|..:..|   |.|.
Zfish    53 ELPKEWDWRNIKGVNYVSTTRNQHIPQYCGSCWAHGSTSALADRINIKRKAAWPSAYL---SVQN 114

  Fly   446 LLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQCH-FNR--TLSHVQVAGFVDLP 507
            ::||....| |:||.....::...: .|:..|....|:||...|. ||:  |.:...|...|.  
Zfish   115 VIDCGDAGS-CSGGDHSGVWEYAHN-KGIPDETCNNYQAKDQDCKPFNQCGTCTTFGVCNIVK-- 175

  Fly   508 KGNET--------------AMQEWLLANGPISIGINA-NAMQFYRGG-----VSHPWKALCSKKN 552
              |.|              .|:..:.:.||||.||.| :.:..|.||     |..|:        
Zfish   176 --NFTLWKVGDYGSASGLDKMKAEIYSGGPISCGIMATDKLDAYTGGLYSEYVQEPY-------- 230

  Fly   553 LDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRV----YRG 598
            ::|.|.|.|:||.:     ..:.:|:|:||||..|||:|:.|:    |:|
Zfish   231 INHIVSVAGWGVDE-----NGVEFWVVRNSWGEPWGEKGWLRIVTSAYKG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458
Peptidase_C1A 395..611 CDD:239068 74/243 (30%)
ctszNP_001006043.1 Peptidase_C1A_CathepsinX 54..295 CDD:239149 75/244 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.