DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and zgc:103438

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001006036.1 Gene:zgc:103438 / 450015 ZFINID:ZDB-GENE-041010-131 Length:311 Species:Danio rerio


Alignment Length:105 Identity:26/105 - (24%)
Similarity:46/105 - (43%) Gaps:22/105 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 DEHEITFKCRNQPVVQARHTRSVEWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMR 328
            :||:|.    ..|:.....|..|         .|:||      :|..|:.:|.::|.|..|.:.|
Zfish   226 EEHQIL----ANPIQDYVSTNPV---------SHAHR------MFGPFKEKFNQQYKSEKEHEKR 271

  Fly   329 LRIFRQNLKTIEELNANEMG-SAKYGITEFADMTSSEYKE 367
            ..||...|:.:.  :.|.:| |...||.:.:|.:.:|.::
Zfish   272 EIIFVHTLRFVH--SRNRVGLSFSLGINDRSDWSRAEKRK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856 3/7 (43%)
Inhibitor_I29 308..365 CDD:285458 16/57 (28%)
Peptidase_C1A 395..611 CDD:239068
zgc:103438NP_001006036.1 Inhibitor_I29 251..306 CDD:285458 16/56 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.