DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctsll

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_005165198.1 Gene:ctsll / 449826 ZFINID:ZDB-GENE-041010-76 Length:337 Species:Danio rerio


Alignment Length:333 Identity:128/333 - (38%)
Similarity:184/333 - (55%) Gaps:44/333 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 WAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELN-ANEMG--S 349
            |.||..|:|                           |...|..::.:|||.||..| .:.:|  :
Zfish    35 WHEKSYHEK---------------------------EEGWRRMVWEKNLKKIELHNLEHSVGKHT 72

  Fly   350 AKYGITEFADMTSSEYKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGS 414
            .:.|:.:|.|||:.|:::....:.||..:.:.||..:.|::. ..|::.|||||..||.:|:|..
Zfish    73 FRLGMNQFGDMTNEEFRQAMNGYNRDPNRKSKGSLFIEPSFF-TAPQQIDWRQKGYVTPIKDQKR 136

  Fly   415 CGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYE 477
            ||||||||.||.:||....|||:|...|||.|:||...  ::.|:|||||.|::.::|..||:.|
Zfish   137 CGSCWAFSSTGALEGQVFRKTGKLVSLSEQNLMDCSRPQGNNGCDGGLMDQAFQYVQDNNGLDSE 201

  Fly   478 AEYPYKAKKNQ-CHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINA--NAMQFYRGG 539
            ..|||.|..:| ||::...|...|.||||:|.|.|.|:.:.:.|.||:::.|:|  .:.|||:.|
Zfish   202 ESYPYLATDDQPCHYDPRYSAANVTGFVDIPSGKEHALMKAVAAVGPVAVAIDAGHESFQFYQSG 266

  Fly   540 VSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGY-YRVYRGDNTCG 603
            :.  ::..||.:.|||||||||||........:.  ||||||||..|||::|| |......|.||
Zfish   267 IY--YEKACSTEELDHGVLVVGYGYEGVDVAGRR--YWIVKNSWTDRWGDKGYIYMAKDLKNHCG 327

  Fly   604 VSEMATSA 611
            :   ||||
Zfish   328 I---ATSA 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 14/59 (24%)
Peptidase_C1A 395..611 CDD:239068 101/221 (46%)
ctsllXP_005165198.1 Inhibitor_I29 29..87 CDD:214853 19/78 (24%)
Peptidase_C1 116..336 CDD:278538 103/224 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.