DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctss

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001005695.1 Gene:ctss / 448203 XenbaseID:XB-GENE-953011 Length:333 Species:Xenopus tropicalis


Alignment Length:346 Identity:122/346 - (35%)
Similarity:180/346 - (52%) Gaps:51/346 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 VVQARHTRSVE-----WAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNL 336
            :|:||...:::     |  |.||.|...  |:::.|                  |.|: .:.:||
 Frog    14 IVKARINPALDNHWLLW--KNTHNKDYE--DEIEDL------------------QRRI-TWEKNL 55

  Fly   337 KTIEELNAN-EMGSAKY--GITEFADMTSSEYKER-TGLW--QRDEAKATGGSAAVVPAYHGELP 395
            ..:...|.. .||...|  |:...|||||.|.|.: |||.  .:.|.:|| .|:.....:.|::|
 Frog    56 NLVNMHNLEYSMGMHTYELGMNHLADMTSEEIKSKLTGLILPPQSERQAT-FSSQKNSTFGGKVP 119

  Fly   396 KEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNG 458
            ...|||.|..|:.|||||.||||||||..|.:||...:|||:|...|.|.|:||.:.  :..|.|
 Frog   120 DSIDWRDKGCVSDVKNQGGCGSCWAFSAVGALEGQLMLKTGKLVSLSPQNLVDCSSKYGNKGCGG 184

  Fly   459 GLMDNAYKAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGP 523
            |.|..|::.:.|..|::.::.|||.|...:||::.|......|.:.::..|.|..:::.|.:.||
 Frog   185 GFMTQAFQYVIDNKGIDSDSYYPYHAMDEKCHYDPTGKASTCAKYTEIVPGTEDNLKQALGSIGP 249

  Fly   524 ISIGINANAMQF--YRGGV-SHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGP 585
            ||:.|:.....|  ||.|| |.|   .||.: ::||||.||||..:..:|      |::|||||.
 Frog   250 ISVAIDGTRPSFFLYRSGVYSDP---TCSHE-VNHGVLAVGYGNLNGQDF------WLLKNSWGT 304

  Fly   586 RWGEQGYYRVYRG-DNTCGVS 605
            ::|:|||.|:.|. .|.|||:
 Frog   305 KYGDQGYVRIARNKGNLCGVA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 14/59 (24%)
Peptidase_C1A 395..611 CDD:239068 88/217 (41%)
ctssNP_001005695.1 Inhibitor_I29 27..87 CDD:369782 21/82 (26%)
Peptidase_C1A 119..331 CDD:239068 88/217 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.