DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctsl.1

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001002368.1 Gene:ctsl.1 / 436641 ZFINID:ZDB-GENE-040718-61 Length:334 Species:Danio rerio


Alignment Length:323 Identity:130/323 - (40%)
Similarity:185/323 - (57%) Gaps:33/323 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 DHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLK--TIEELNANE-MGSAKYGITEFADMTSSEYK 366
            |..|:.::::||:.|.|..|...|...:..|.|  .:..:.|:: :.|.:.|:|.||||::.||:
Zfish    23 DMEFHAWKLKFGKSYRSAEEESHRQLTWLTNRKLVLVHNMMADQGLKSYRLGMTYFADMSNEEYR 87

  Fly   367 E---RTGLWQRDEAKATGGS-------AAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAF 421
            :   |..|...:..||.|||       ||||       |...|||.|..||.:|:|..|||||||
Zfish    88 QLVFRGCLGSMNNTKARGGSTFFRLRKAAVV-------PDTVDWRDKGYVTDIKDQKQCGSCWAF 145

  Fly   422 SVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYEAEYPYKA 484
            |.||::||....|||:|...|||:|:||..:  :..|:|||||.|::.|:...||:.|..|||:|
Zfish   146 SATGSLEGQTFRKTGKLVSLSEQQLVDCSGSYGNYGCDGGLMDQAFQYIEANKGLDTEDSYPYEA 210

  Fly   485 KKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINA--NAMQFYRGGVSHPWKAL 547
            :..:|.||.:.......|:||:..|:|:|:||.:...||||:.|:|  ::.|.|..||.:  :..
Zfish   211 QDGECRFNPSTVGASCTGYVDIASGDESALQEAVATIGPISVAIDAGHSSFQLYSSGVYN--EPD 273

  Fly   548 CSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DNTCGVSEMAT 609
            ||...||||||.||||.|:..:      |||||||||..||.|||..:.|. .|.||::..|:
Zfish   274 CSSSELDHGVLAVGYGSSNGDD------YWIVKNSWGLDWGVQGYILMSRNKSNQCGIATAAS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 17/59 (29%)
Peptidase_C1A 395..611 CDD:239068 99/220 (45%)
ctsl.1NP_001002368.1 Inhibitor_I29 26..86 CDD:285458 17/59 (29%)
Peptidase_C1 118..333 CDD:278538 100/228 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.