DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Y71H2AM.25

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001040887.1 Gene:Y71H2AM.25 / 4363054 WormBaseID:WBGene00044760 Length:299 Species:Caenorhabditis elegans


Alignment Length:321 Identity:95/321 - (29%)
Similarity:150/321 - (46%) Gaps:62/321 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 RYVSTAERQMRLRI--------FRQNLKTIEELNANEMGSAK----YGITEFADMTSSEYKERTG 370
            |.:|.|:...:.::        |.:..|:..:||:..:.:..    |.|.......:||....|.
 Worm     6 RLISKADEAKKQKVFVALGEDFFEKPAKSRNKLNSIILFTLTALTFYIIGYLVQQRTSESLPTTF 70

  Fly   371 LWQRDEAKATGGSAAVVPAYHGELPKEF-DWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVK 434
            .|:             .|.|..:..:|| |||.|..|..||:||.|.:..||:::.:||.:||..
 Worm    71 QWK-------------TPKYTIQTTEEFLDWRDKGIVGPVKDQGKCNASHAFAISSSIESMYAKA 122

  Fly   435 T-GELKEFSEQELLDCDTTDSACNGGLMDNAYKAIKD-----------IGGLEYEAEYPYKAKKN 487
            | |.|..||||:|:|||           |:.:|..::           ..|:|.||:|||..|:|
 Worm   123 TNGSLLSFSEQQLIDCD-----------DHGFKGCEEQPAINAVSYFIFHGIETEADYPYAGKEN 176

  Fly   488 -QCHFNRTLSHVQV--AGFVDLPKGNETAMQEWLLANGPISIGINA-NAMQFYRGGVSHPWKALC 548
             :|.|:.|.|.:|:  |.||   ..|||..:|.:...||....:.| .::..|:.|:.:|....|
 Worm   177 GKCTFDSTKSKIQLKDAEFV---VSNETQGKELVTNYGPAFFTMRAPPSLYDYKIGIYNPSIEEC 238

  Fly   549 SKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMAT 609
            :..:....:::||||:.....      |||||.|:|..||||||.::.|..|.|.:::..|
 Worm   239 TSTHEIRSMVIVGYGIEGVQK------YWIVKGSFGTSWGEQGYMKLARDVNACAMADFIT 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 10/58 (17%)
Peptidase_C1A 395..611 CDD:239068 80/232 (34%)
Y71H2AM.25NP_001040887.1 Peptidase_C1A 84..295 CDD:239068 80/230 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.