DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctsc

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_012812143.2 Gene:ctsc / 407938 XenbaseID:XB-GENE-940480 Length:458 Species:Xenopus tropicalis


Alignment Length:315 Identity:101/315 - (32%)
Similarity:148/315 - (46%) Gaps:57/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 RIFRQNLKTIEELNANEMGSAKYGITEFADMTSSEYKERTGLWQRDEAKATGGSAAVVP------ 388
            |::..|...::::|..:           ...|::.|.|..|:...|..:..||..:.:|      
 Frog   162 RLYNYNHDFVKQINEVQ-----------KSWTATAYPEYEGMTIEDLIRRAGGRNSRIPMRPRPA 215

  Fly   389 ------AYHGELPKEFDWRQ---KDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKE---F 441
                  .|.| ||.|:|||.   .:.||.|:||.|||||:|||..|.:|....::: :|.:   .
 Frog   216 PLPTDEKYQG-LPTEWDWRNIAGYNFVTPVRNQASCGSCYAFSSMGMLESRIQIRS-QLSQKPIL 278

  Fly   442 SEQELLDCDTTDSACNGG---LMDNAYKAIKDIGGLEYEAEYPYKAKKNQCHFN------RTLSH 497
            |.|:::.|......|.||   |:  |.|.:.|.|.:| |::.||....:.|...      .|..:
 Frog   279 SPQQVVSCSNYSQGCEGGFPYLI--AGKYVSDYGIVE-ESDLPYTGSDSPCTLKDSQQKYYTAEY 340

  Fly   498 VQVAGFVDLPKG-NETAMQEWLLANGPISIGINA-NAMQFYRGGVSHPWKALCSKKN----LDHG 556
            ..|.||..   | ||..|:..|:..||:|:.... :....||.||.| ...|..|.|    .:|.
 Frog   341 HYVGGFYG---GCNEAYMKLELVLGGPLSVAFEVYDDFMHYRSGVYH-HTGLQDKFNPFQLTNHA 401

  Fly   557 VLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMATSA 611
            ||:|||| :|.....|   |||||||||..|||:||:|:.||.:.|.:..:|.||
 Frog   402 VLLVGYG-TDQQTGEK---YWIVKNSWGESWGEKGYFRIRRGTDECAIESIAVSA 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 4/34 (12%)
Peptidase_C1A 395..611 CDD:239068 85/236 (36%)
ctscXP_012812143.2 CathepsinC_exc 20..136 CDD:400909
Peptidase_C1A_CathepsinC 226..455 CDD:239112 88/239 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.