DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and CG11459

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster


Alignment Length:333 Identity:95/333 - (28%)
Similarity:155/333 - (46%) Gaps:32/333 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 RFDKVDHLFYKFQVRFGRRYVSTAE---------RQMRLR------IFRQNLKTIE---ELNANE 346
            |...|..|.....|..|...||..|         :|.|.|      ::.|.:..:|   :|....
  Fly     5 RLTVVHGLILLLLVELGLTAVSDTEWDQYKAKYNKQYRNRDKYHRALYEQRVLAVESHNQLYLQG 69

  Fly   347 MGSAKYGITEFADMTSSE--YKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQV 409
            ..:.|.|:.:|:| |...  :..|:.:....|......:..|....:.::.:..||||...::.|
  Fly    70 KVAFKMGLNKFSD-TDQRILFNYRSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGYISPV 133

  Fly   410 KNQGS-CGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDC-DTTDSACNGGLMDNAYKAIKDIG 472
            .:||: |.||||||.:|.:|...|.|.|.|...|.:.|:|| ...::.|:||.:..|:...:| .
  Fly   134 GDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRD-H 197

  Fly   473 GLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQF-- 535
            |:..:..|||:....:|.:....|...::|:|.|...:|..:.|.:...||:::.|:....:|  
  Fly   198 GIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQ 262

  Fly   536 YRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYR-GD 599
            |.|||.........:::|.|.||:||:|     ...|...|||:|||:|..|||.||.::.| .:
  Fly   263 YSGGVLSIPACRSKRQDLTHSVLLVGFG-----THRKWGDYWIIKNSYGTDWGESGYLKLARNAN 322

  Fly   600 NTCGVSEM 607
            |.|||:.:
  Fly   323 NMCGVASL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 16/76 (21%)
Peptidase_C1A 395..611 CDD:239068 73/218 (33%)
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 11/55 (20%)
Peptidase_C1A 120..334 CDD:239068 73/217 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452960
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.