DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctsba

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_998501.1 Gene:ctsba / 406645 ZFINID:ZDB-GENE-040426-2650 Length:330 Species:Danio rerio


Alignment Length:301 Identity:78/301 - (25%)
Similarity:125/301 - (41%) Gaps:63/301 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 FADMTSSEYKERTGLWQRDEAKATGGSAAVVPAY-HG-ELPKEFD----WRQKDAVTQVKNQGSC 415
            |.|:..|..|:..|.:.:      |....|:..| .| :|||.||    |.....:.::::||||
Zfish    46 FRDVDYSYVKKLCGTFLK------G
PKLPVMVQYTEGLKLPKNFDAREQWPNCPTLKEIRDQGSC 104

  Fly   416 GSCWAFSVTGNIEGLYAVKTGELK---EFSEQELLD-CDTTDSACNGGLMDNAYK--AIKDI--G 472
            ||||||.....|.....:.: :.|   |.|.|:||. ||:....||||....|:.  |.:.:  |
Zfish   105 GSCWAFGAAEAISDRVCIHS-DAKVSVEISSQDLLTCCDSCGMGCNGGYPSAAWDFWATEGLVTG 168

  Fly   473 GLEYEAEY---PYKAKKNQCHFNRTL-----------------------SHVQVAGF----VDLP 507
            || |.:..   ||..:..:.|.|.:.                       |:.|...|    ..:|
Zfish   169 GL-YNSHIGCRPYTIEPCEHHVNGSRPPCSGEGGDTPNCDMKCEPGYSPSYKQDKHFGKTSYSVP 232

  Fly   508 KGNETAMQEWLLANGPISIGINA-NAMQFYRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFH 571
            ....:.|.| |..|||:...... .....|:.||   ::.:.......|.:.::|:|..:     
Zfish   233 SNQNSIMAE-LFKNGPVEGAFTVYEDFLLYKSGV---YQHMSGSPVGGHAIKILGWGEEN----- 288

  Fly   572 KTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMATSAV 612
             .:|||:..|||...||:.||:::.||::.||:.....:.:
Zfish   289 -GVPYWLAANSWNTDWGDNGYFKILRGEDHCGIESEIVAGI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 3/7 (43%)
Peptidase_C1A 395..611 CDD:239068 68/258 (26%)
ctsbaNP_998501.1 Propeptide_C1 25..64 CDD:285358 5/23 (22%)
Peptidase_C1A_CathepsinB 80..327 CDD:239111 68/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.