DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Swim

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster


Alignment Length:233 Identity:71/233 - (30%)
Similarity:102/233 - (43%) Gaps:26/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 LPKEFDWRQK--DAVTQVKNQGSCGSCWAFSVTGNIEGLYAV--KTGELKEFSEQELLDCDTTDS 454
            ||..|:...|  ..:::|.:||.||:.|..|.|......:|:  |..|..:.|.|.:|.|.....
  Fly   187 LPSSFNALDKWSSYISEVPDQGWCGASWVLSTTSVASDRFAIQSKGKENVQLSAQNILSCTRRQQ 251

  Fly   455 ACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQC---HFNRTL--SHVQVAGFVDLPK------ 508
            .|.||.:|.|::.:...|.:: |..|||...::.|   |.:|:|  :..|....||...      
  Fly   252 GCEGGHLDAAWRYLHKKGVVD-ENCYPYTQHRDTCKIRHNSRSLRANGCQKPVNVDRDSLYTVGP 315

  Fly   509 ----GNETAMQEWLLANGPISIGINANAMQF-YRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYP 568
                ..|..:...:..:||:...:..|...| |.|||.....|........|.|.:||:|..   
  Fly   316 AYSLNREADIMAEIFHSGPVQATMRVNRDFFAYSGGVYRETAANRKAPTGFHSVKLVGWGEE--- 377

  Fly   569 NFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSE 606
              |....|||..||||..|||.||:|:.||.|.||:.|
  Fly   378 --HNGEKYWIAANSWGSWWGEHGYFRILRGSNECGIEE 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458
Peptidase_C1A 395..611 CDD:239068 70/232 (30%)
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385
VWC 91..>126 CDD:302663
Peptidase_C1A_CathepsinB 188..417 CDD:239111 70/232 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452969
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.