DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsF and cer

DIOPT Version :10

Sequence 1:NP_730901.1 Gene:CtsF / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster


Alignment Length:69 Identity:23/69 - (33%)
Similarity:35/69 - (50%) Gaps:4/69 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 DHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNAN-EMGSA--KYGITEFADMTSSEYK 366
            |..:.:::.:|.:.| ...|..||.||:.::...|||.|.. |.|..  |.||...||:|..|:.
  Fly     6 DEEWVEYKSKFDKNY-EAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFA 69

  Fly   367 ERTG 370
            :|.|
  Fly    70 QRCG 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsFNP_730901.1 Inhibitor_I29 308..365 CDD:462410 19/59 (32%)
Peptidase_C1A 395..611 CDD:239068
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 19/59 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.