DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12163 and cer

DIOPT Version :9

Sequence 1:	NP_730901.1	Gene:	CG12163 / 40628	FlyBaseID:	FBgn0260462	Length:	614	Species:	Drosophila melanogaster
Sequence 2:	NP_611420.1	Gene:	cer / 37229	FlyBaseID:	FBgn0034443	Length:	79	Species:	Drosophila melanogaster

Alignment Length:	69	Identity:	23/69 - (33%)
Similarity:	35/69 - (50%)	Gaps:	4/69 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   305 DHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNAN-EMGSA--KYGITEFADMTSSEYK 366
            |..:.:::.:|.:.| ...|..||.||:.::...|||.|.. |.|..  |.||...||:|..|:.
  Fly     6 DEEWVEYKSKFDKNY-EAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFA 69

  Fly   367 ERTG 370
            :|.|
  Fly    70 QRCG 73

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12163	NP_730901.1	CY	194..272	CDD:298856
		Inhibitor_I29	308..365	CDD:285458	19/59 (32%)
		Peptidase_C1A	395..611	CDD:239068
cer	NP_611420.1	Inhibitor_I29	9..68	CDD:400519	19/59 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4870
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900