DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctsc

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_999887.1 Gene:ctsc / 368704 ZFINID:ZDB-GENE-030619-9 Length:455 Species:Danio rerio


Alignment Length:330 Identity:93/330 - (28%)
Similarity:156/330 - (47%) Gaps:54/330 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 RFGRRYVSTAERQMRLRI-FRQNLKTIEELNANEMGSAKYGITEFADMTSSEYKERTGLWQRDEA 377
            |..||::...|.::.::: :..|:..::|:|:.:           ...|::.|.....|...:..
Zfish   142 RVDRRHMLGFEHRLLMKLPYTNNMMFVDEINSVQ-----------KSWTATAYSFHETLSIHEML 195

  Fly   378 KATGGSAAVVP-------------AYHGELPKEFDWRQKDA---VTQVKNQGSCGSCWAFSVTGN 426
            :.:||.|:.:|             |..| ||:.:|||..:.   |:.|:||..||||::|:..|.
Zfish   196 RRSGGPASRIPRRVRPVTVAADSKAASG-LPQHWDWRNVNGVNFVSPVRNQAQCGSCYSFATMGM 259

  Fly   427 IEGLYAVKTGELKE--FSEQELLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQC 489
            :|....::|...::  ||.|:::.|......|:||......|.|:|.|.:|.:. :||....:.|
Zfish   260 LEARVRIQTNNTQQPVFSPQQVVSCSQYSQGCDGGFPYLIGKYIQDFGIVEEDC-FPYTGSDSPC 323

  Fly   490 HFNRTLS------HVQVAGFVDLPKG-NETAMQEWLLANGPISIGINANA-MQFYRGGVSHPWKA 546
            :.....:      :..|.||..   | :|:||...|:.|||:.:.:.... ...|:.|:.| ...
Zfish   324 NLPAKCTKYYASDYHYVGGFYG---GCSESAMMLELVKNGPMGVALEVYPDFMNYKEGIYH-HTG 384

  Fly   547 LCSKKN----LDHGVLVVGYGVSDYPNFHKT-LPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSE 606
            |....|    .:|.||:||||     ..||| ..|||||||||..|||.|::|:.||.:.|.:..
Zfish   385 LRDANNPFELTNHAVLLVGYG-----QCHKTGEKYWIVKNSWGSGWGENGFFRIRRGTDECAIES 444

  Fly   607 MATSA 611
            :|.:|
Zfish   445 IAVAA 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 8/51 (16%)
Peptidase_C1A 395..611 CDD:239068 75/233 (32%)
ctscNP_999887.1 CathepsinC_exc 20..132 CDD:285926
Peptidase_C1A_CathepsinC 224..452 CDD:239112 77/236 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.