DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and CG6357

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster


Alignment Length:299 Identity:62/299 - (20%)
Similarity:107/299 - (35%) Gaps:92/299 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 EEAAKAQLQKSLDKLTAGEGPHYKIVKVYSASRQVDSGILTRIDADLIDGSEEQHRCIVD--IWT 257
            ||..|...|.:.:|.....|..||........|.|...               ..|.||:  :..
  Fly   151 EERDKVNCQAAWEKFLIDFGAQYKNANETEKRRNVFCA---------------NWRAIVEHNVQY 200

  Fly   258 KVWVRKDEHEI------TFKCRNQPVVQARHTRSVEWAEKKTHKKHSHRFDKVDH-------LFY 309
            :.|....:.:|      |.:.|:.|..:.|.    |.|...|        .::|:       .:.
  Fly   201 EKWAEPFKRDINQWTDHTIEERSSPAPEIRK----EEATTST--------SEIDNDNIICQPAWE 253

  Fly   310 KFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNAN-EMG--SAKYGITEFADMTSSEYKERTGL 371
            ||.:.|...|....|.:.|..:|..|.|:|.:.|.. ::|  |.|.||.:::|:|..|:|.:   
  Fly   254 KFLIDFKPSYQDDTETEKRRNVFCDNFKSIHKHNVQFDLGNISFKKGINQWSDLTVEEWKNK--- 315

  Fly   372 WQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQV----KNQGSCGSCW-AFSVTGNIEGLY 431
             ||             ||::.|..|      .:|.|::    ::..:|.:.| .|.:.      :
  Fly   316 -QR-------------PAFNPEFSK------VEATTKISKDKRDDNTCQAAWKKFLID------F 354

  Fly   432 AVKTGELKEFSEQELLDCDTTDSACNGGLMDNAYKAIKD 470
            ..|..:.||..::..:.||.             :|||::
  Fly   355 GAKYQDEKETEKRRTIFCDN-------------WKAIQE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856 16/84 (19%)
Inhibitor_I29 308..365 CDD:285458 18/59 (31%)
Peptidase_C1A 395..611 CDD:239068 14/81 (17%)
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458
Inhibitor_I29 162..221 CDD:214853 12/73 (16%)
Inhibitor_I29 252..311 CDD:214853 18/58 (31%)
Inhibitor_I29 347..406 CDD:214853 10/53 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.