DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and CG5367

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:316 Identity:106/316 - (33%)
Similarity:167/316 - (52%) Gaps:23/316 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 FYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNAN-EMGSAKYGITE--FADMTSSEY-KER 368
            |.||:....|:|:.|.:.....:.|.:|.|.|||.|.| :.|...:.:..  ||||::..| |..
  Fly    36 FEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTDGYLKGF 100

  Fly   369 TGLWQRDEAKATGGSAAVVPA-YHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYA 432
            ..|.:.:...:....|.:|.: ....:|:..|||.|..:|...||.|||||:|||:..:|.|...
  Fly   101 LRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITPPYNQLSCGSCYAFSIAESIMGQVF 165

  Fly   433 VKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQCHFNRTL 495
            .:||::...|:|:::||..:  :..|.||.:.|....::..||:..:.:|||.|:|.:|.|...|
  Fly   166 KRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKGKCQFVPDL 230

  Fly   496 SHVQVAGFVDLPKGNETAMQEWLLANGPISIGINAN--AMQFYRGGV-SHPWKALCSKKNLDHGV 557
            |.|.|..:..||..:|.|:|..:...||::|.|||:  ..|.|..|: ..|   |||..:::|.:
  Fly   231 SVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDP---LCSSASVNHAM 292

  Fly   558 LVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMATSAVL 613
            :|:|:|..          |||:||.||..|||.||.|:.:|.|.||::..|..|::
  Fly   293 VVIGFGKD----------YWILKNWWGQNWGENGYIRIRKGVNMCGIANYAAYAIV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 19/59 (32%)
Peptidase_C1A 395..611 CDD:239068 81/220 (37%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 19/59 (32%)
Peptidase_C1A 128..336 CDD:239068 81/220 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452958
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.