DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctss2.2

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_009290599.1 Gene:ctss2.2 / 337572 ZFINID:ZDB-GENE-050626-55 Length:337 Species:Danio rerio


Alignment Length:330 Identity:116/330 - (35%)
Similarity:172/330 - (52%) Gaps:40/330 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 SHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLK--TIEELNANEMGSAKY--GITEFA 358
            :|....:|..:..::.:..:.|....|...|..::.:||:  .|..|.|: ||...|  .|...|
Zfish    24 AHFNTNLDQHWELWKKKHVKLYSCEDEEVGRRELWERNLELIAIHNLEAS-MGMHSYDLAINHMA 87

  Fly   359 DMTSSEYKERTGL------WQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGS 417
            |||:.|..:...:      ::|..|:....|.|||       |...|||.|..||.|||||:|||
Zfish    88 DMTTEEILQTLAVTRVPPGFKRPTAEYVSSSFAVV-------PDTLDWRDKGYVTSVKNQGACGS 145

  Fly   418 CWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYEAEY 480
            |||||..|.:||.....||:|.:.|.|.|:||.:.  :..||||.|..|::.:.|.||::.|:.|
Zfish   146 CWAFSSVGALEGQLMKTTGKLVDLSPQNLVDCSSKYGNLGCNGGYMSQAFQYVIDNGGIDSESSY 210

  Fly   481 PYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQ--FYRGGV-SH 542
            ||:..:..|.::.:........:..:.:|:|.|::|.|...||:|:.|:|...|  |||.|| ..
Zfish   211 PYQGTQGSCRYDPSQRAANCTSYKFVSQGDEQALKEALANIGPVSVAIDATRPQFIFYRSGVYDD 275

  Fly   543 PWKALCSKKNLDHGVLVVGYGVSDYPNFHKTL---PYWIVKNSWGPRWGEQGYYRVYRG-DNTCG 603
            |   .|::| ::||||.||||         ||   .||:||||||..:|:.||.|:.|. :|.||
Zfish   276 P---SCTQK-VNHGVLAVGYG---------TLSGQDYWLVKNSWGAGFGDGGYIRIARNKNNMCG 327

  Fly   604 VSEMA 608
            ::..|
Zfish   328 IASEA 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 16/60 (27%)
Peptidase_C1A 395..611 CDD:239068 91/223 (41%)
ctss2.2XP_009290599.1 Inhibitor_I29 34..93 CDD:214853 16/59 (27%)
Peptidase_C1 122..336 CDD:278538 92/231 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.