DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AgaP_AGAP012900

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_560736.1 Gene:AgaP_AGAP012900 / 3292489 VectorBaseID:AGAP012900 Length:135 Species:Anopheles gambiae


Alignment Length:142 Identity:48/142 - (33%)
Similarity:71/142 - (50%) Gaps:13/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 EAEY-PYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINA--NAMQFYRG 538
            |.|| .|..:...||......:..:.|:|::..|:..|.:..|..:||:||.|:|  .:..||..
Mosquito     2 EDEYGGYFGQDGYCHVQNMTLYAPITGWVNVTSGDPDAFKLALFKHGPLSIAIDAGHKSFSFYSN 66

  Fly   539 GVSHPWKALCSKK--NLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNT 601
            ||.  ::..|..|  .|||.||.||||..:..:      ||::||||...||..||..:...||.
Mosquito    67 GVY--YEPECKNKLDELDHAVLAVGYGQLNGED------YWLIKNSWSNYWGNDGYALMAVKDNN 123

  Fly   602 CGVSEMATSAVL 613
            ||::..||..::
Mosquito   124 CGLTTDATYVLM 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458
Peptidase_C1A 395..611 CDD:239068 48/138 (35%)
AgaP_AGAP012900XP_560736.1 Peptidase_C1A <2..133 CDD:239068 48/138 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.