DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctsh

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_997853.1 Gene:ctsh / 324818 ZFINID:ZDB-GENE-030131-3539 Length:330 Species:Danio rerio


Alignment Length:307 Identity:109/307 - (35%)
Similarity:167/307 - (54%) Gaps:19/307 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 DHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKY--GITEFADMTSSEYKE 367
            ::.|..:..::.::| ...|...||:||.:|.|.|::.|.   |:.|:  |:.:|:|||.:|:|:
Zfish    27 EYHFKSWMSQYNKKY-EINEFYQRLQIFLENKKRIDQHNE---GNHKFSMGLNQFSDMTFAEFKK 87

  Fly   368 RTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQK-DAVTQVKNQGSCGSCWAFSVTGNIEGLY 431
            ...|.:.....||.|:..   :.:|..|...|||.| ..:|.|||||.|||||.||.||.:|.:.
Zfish    88 TYLLTEPQNCSATRGNHV---SSNGLYPDAIDWRTKGHYITDVKNQGPCGSCWTFSTTGCLESVT 149

  Fly   432 AVKTGELKEFSEQELLDC--DTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQCHFNRT 494
            |:.||:|.:.:||:|:||  |..:..|||||..:|::.|....||..|.:|||:||..||.|...
Zfish   150 AIATGKLLQLAEQQLIDCAGDFDNHGCNGGLPSHAFEYIMYNKGLMTEDDYPYQAKGGQCRFKPQ 214

  Fly   495 LSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANA-MQFYRGGVSHPWKALCSKKNLDHGVL 558
            |:...|...|::.|.:|..|.:.:....|:|......: ...|:.|:....:...:...::|.||
Zfish   215 LAAAFVKEVVNITKYDEMGMVDAVARLNPVSFAYEVTSDFMHYKDGIYTSTECHNTTDMVNHAVL 279

  Fly   559 VVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVS 605
            .|||...:      ..||||||||||..||.:||:.:.||.|.||::
Zfish   280 AVGYAEEN------GTPYWIVKNSWGTNWGIKGYFYIERGKNMCGLA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 18/58 (31%)
Peptidase_C1A 395..611 CDD:239068 84/215 (39%)
ctshNP_997853.1 Inhibitor_I29 30..85 CDD:285458 18/58 (31%)
Peptidase_C1 112..327 CDD:278538 84/215 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.