DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and CtsB1

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster


Alignment Length:325 Identity:88/325 - (27%)
Similarity:134/325 - (41%) Gaps:81/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 EFADMTSSEYKERTGLWQRDEAKATGGS----AAVVPAYH-------------------GELPKE 397
            ||.::..|:.|..| :.:..:|..|.|.    ..|.|..|                   .|||:|
  Fly    27 EFIEVVRSKAKTWT-VGRNFDASVTEGHIRRLMGVHPDA
HKFALPDKREVLGDLYVNSVDELPEE 90

  Fly   398 FD----WRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELK--EFSEQELLD-CDTTDSA 455
            ||    |.....:.::::||||||||||.....:.....:.:|...  .||..:|:. |.|....
  Fly    91 FDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFG 155

  Fly   456 CNGGLMDNAY-----KAIKDIGGLEYEAEY---PYKAKKNQCHFNRT------------LSHVQV 500
            ||||....|:     |.|  :.|..|.:..   ||:....:.|.|.|            .|||..
  Fly   156 CNGGFPGAAWSYWTRKGI--VSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQ 218

  Fly   501 AGF-VDLPKG------------NETAMQEWLLANGPISIGINA-NAMQFYRGGV---SHPWKALC 548
            :|: ||..|.            |...:||.::.|||:...... ..:..|:.||   .|      
  Fly   219 SGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQHEH------ 277

  Fly   549 SKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMATSAVL 613
            .|:...|.:.::|:||..    .:.:|||::.|||...||:.|::|:.||.:.||: |.:.||.|
  Fly   278 GKELGGHAIRILGWGVWG----EEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGI-ESSISAGL 337

  Fly   614  613
              Fly   338  337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 3/8 (38%)
Peptidase_C1A 395..611 CDD:239068 72/259 (28%)
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 10/37 (27%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 73/260 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452965
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.