DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and CG31313

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001262567.1 Gene:CG31313 / 318677 FlyBaseID:FBgn0051313 Length:124 Species:Drosophila melanogaster


Alignment Length:97 Identity:32/97 - (32%)
Similarity:56/97 - (57%) Gaps:6/97 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 GRHKPYDEE---AAKAQLQKSLDKLTAGEGPHYKIVKVYSASRQVDSGILTRIDADLIDGSEEQH 249
            |..||.|.:   .||..|..:|.||..|:||:|::|.|.|||.|:.:|.|.:.:..|.:|:|.: 
  Fly    26 GAPKPLDGDDLSKAKELLDTTLAKLATGDGPNYQVVNVISASSQLVAGSLYKFEVKLSNGAETK- 89

  Fly   250 RCIVDIWTKVWVRK--DEHEITFKCRNQPVVQ 279
            .|.|.||.:.|:.:  :...:..:|:::.|::
  Fly    90 ECNVKIWDRPWLHEQGEATNVKVQCKDEDVLE 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856 27/82 (33%)
Inhibitor_I29 308..365 CDD:285458
Peptidase_C1A 395..611 CDD:239068
CG31313NP_001262567.1 CY 25..115 CDD:298856 30/89 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D71650at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.