DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and ctslb

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_571273.2 Gene:ctslb / 30443 ZFINID:ZDB-GENE-980526-285 Length:352 Species:Danio rerio


Alignment Length:320 Identity:120/320 - (37%)
Similarity:186/320 - (58%) Gaps:23/320 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 KVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELN-----ANEMGSAKYGITEFADMTS 362
            ::|..:..::.:.|:.|....|...|: |:.:||:.||:.|     .|.  :.|.|:.:|.|||:
Zfish    39 QLDDHWNSWKSQHGKSYHEDVEVGRRM-IWEENLRKIEQHNFEYSYGNH--TFKMGMNQFGDMTN 100

  Fly   363 SEYKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNI 427
            .|:::....:..|..:.:.|...:.|::.. .|::.||||:..||.||:|..|||||:||.||.:
Zfish   101 EEFRQAMNGYTHDPNQTSQGPLFMEPSFFA-APQQVDWRQRGYVTPVKDQKQCGSCWSFSSTGAL 164

  Fly   428 EGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKN-QC 489
            ||....|||:|...|||.|:||...  :..|||||||.|::.:|:..||:.|..|||.|:.: .|
Zfish   165 EGQLFRKTGKLISMSEQNLVDCSRPQGNQGCNGGLMDQAFQYVKENKGLDSEQSYPYLARDDLPC 229

  Fly   490 HFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINAN--AMQFYRGGVSHPWKALCSKKN 552
            .::...:..::.||||:|.|||.|:...:.|.||:|:.|:|:  ::|||:.|:.  ::..||...
Zfish   230 RYDPRFNVAKITGFVDIPSGNELALMNAVAAVGPVSVAIDASHQSLQFYQSGIY--YERACSSSR 292

  Fly   553 LDHGVLVVGYGV--SDYPNFHKTLPYWIVKNSWGPRWGEQGY-YRVYRGDNTCGVSEMAT 609
            |||.|||||||.  :|.....    ||||||||..:||::|| |.....:|.|||:..|:
Zfish   293 LDHAVLVVGYGYQGADVAGNR----YWIVKNSWSDKWGDKGYIYMAKDKNNHCGVATKAS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 17/61 (28%)
Peptidase_C1A 395..611 CDD:239068 98/223 (44%)
ctslbNP_571273.2 Inhibitor_I29 44..102 CDD:214853 17/60 (28%)
Peptidase_C1 131..351 CDD:306594 98/224 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.