DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctsk

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_113748.1 Gene:Ctsk / 29175 RGDID:61810 Length:329 Species:Rattus norvegicus


Alignment Length:363 Identity:124/363 - (34%)
Similarity:181/363 - (49%) Gaps:50/363 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 VWVRKDEHEITFKCRNQPVV----QARHTRSVEW-AEKKTHKKHSHRFDKVDHLFYKFQVRFGRR 318
            :||        ||....|||    ....|...:| ..||||                     |::
  Rat     1 MWV--------FKFLLLPVVSFALSPEETLDTQWELWKKTH---------------------GKQ 36

  Fly   319 YVSTAERQMRLRIFRQNLKTIEELNAN-EMGSAKY--GITEFADMTSSEYKER-TGLWQRDEAKA 379
            |.|..:...|..|:.:|||.|...|.. .:|:..|  .:....||||.|..:: ||| :...:::
  Rat    37 YNSKVDEISRRLIWEKNLKKISVHNLEASLGAHTYELAMNHLGDMTSEEVVQKMTGL-RVPPSRS 100

  Fly   380 TGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQ 444
            ........|.:.|.:|...|:|:|..||.|||||.||||||||..|.:||....|||:|...|.|
  Rat   101 FSNDTLYTPEWEGRVPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQ 165

  Fly   445 ELLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKG 509
            .|:||.:.:..|.||.|..|::.::..||::.|..|||..:...|.:|.|....:..|:.::|.|
  Rat   166 NLVDCVSENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVG 230

  Fly   510 NETAMQEWLLANGPISIGINAN--AMQFYRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHK 572
            ||.|::..:...||:|:.|:|:  :.|||..||.:...  |.:.|::|.|||||||.      .|
  Rat   231 NEKALKRAVARVGPVSVSIDASLTSFQFYSRGVYYDEN--CDRDNVNHAVLVVGYGT------QK 287

  Fly   573 TLPYWIVKNSWGPRWGEQGYYRVYRG-DNTCGVSEMAT 609
            ...|||:|||||..||.:||..:.|. :|.||::.:|:
  Rat   288 GNKYWIIKNSWGESWGNKGYVLLARNKNNACGITNLAS 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856 3/12 (25%)
Inhibitor_I29 308..365 CDD:285458 16/59 (27%)
Peptidase_C1A 395..611 CDD:239068 89/218 (41%)
CtskNP_113748.1 Inhibitor_I29 26..85 CDD:214853 21/79 (27%)
Peptidase_C1 115..327 CDD:278538 89/219 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.