DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctsj

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_058817.1 Gene:Ctsj / 29174 RGDID:69241 Length:334 Species:Rattus norvegicus


Alignment Length:346 Identity:114/346 - (32%)
Similarity:168/346 - (48%) Gaps:67/346 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 EWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAK 351
            ||.:.||                    ::.:.| |..|.:::..::.:|||.| :|:..|.|..|
  Rat    28 EWQDWKT--------------------KYAKSY-SPVEEELKRAVWEENLKMI-QLHNKENGLGK 70

  Fly   352 YGIT----EFADMTSSEYKERTGLWQRDEAKATGGSAAVVPAYHGE----------LPKEFDWRQ 402
            .|.|    .|||.|..|:::..             |..::||....          ||...|||:
  Rat    71 NGFTMEMNAFADTTGEEFRKSL-------------SDILIPAAVTNPSAQKQVSIGLPNFKDWRK 122

  Fly   403 KDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTTD--SACNGGLMDNAY 465
            :..||.|:|||.|||||||:..|.|||....|||.|...|.|.||||..::  :.|..|....|:
  Rat   123 EGYVTPVRNQGKCGSCWAFAAVGAIEGQMFSKTGNLTPLSVQNLLDCSKSEGNNGCRWGTAHQAF 187

  Fly   466 KAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINA 530
            ..:....|||.||.|||:.|...|.::...:...:.|||:||. ||..:...:.:.||:|..|:|
  Rat   188 NYVLKNKGLEAEATYPYEGKDGPCRYHSENASANITGFVNLPP-NELYLWVAVASIGPVSAAIDA 251

  Fly   531 --NAMQFYRGGVSHPWKALCSKKNLDHGVLVVGYGV----SDYPNFHKTLPYWIVKNSWGPRWGE 589
              ::.:||.|||.|  :..||...::|.|||||||.    :|..|      ||::|||||..||.
  Rat   252 SHDSFRFYSGGVYH--EPNCSSYVVNHAVLVVGYGFEGNETDGNN------YWLIKNSWGEEWGI 308

  Fly   590 QGYYRVYRG-DNTCGVSEMAT 609
            .|:.::.:. :|.||::..|:
  Rat   309 NGFMKIAKDRNNHCGIASQAS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 17/60 (28%)
Peptidase_C1A 395..611 CDD:239068 88/224 (39%)
CtsjNP_058817.1 PTZ00203 4..319 CDD:185513 110/334 (33%)
Inhibitor_I29 29..87 CDD:214853 20/79 (25%)
Peptidase_C1 114..331 CDD:278538 89/225 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.